Protein Info for Rru_A1056 in Rhodospirillum rubrum S1H

Annotation: Zinc-containing alcohol dehydrogenase superfamily (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 TIGR02824: putative NAD(P)H quinone oxidoreductase, PIG3 family" amino acids 9 to 333 (325 residues), 487.8 bits, see alignment E=6.6e-151 PF08240: ADH_N" amino acids 34 to 119 (86 residues), 56.8 bits, see alignment E=3.6e-19 PF00107: ADH_zinc_N" amino acids 160 to 284 (125 residues), 112.8 bits, see alignment E=1.7e-36 PF13602: ADH_zinc_N_2" amino acids 192 to 332 (141 residues), 96 bits, see alignment E=5.7e-31

Best Hits

Swiss-Prot: 41% identical to QORX_HUMAN: Quinone oxidoreductase PIG3 (TP53I3) from Homo sapiens

KEGG orthology group: K00344, NADPH2:quinone reductase [EC: 1.6.5.5] (inferred from 100% identity to rru:Rru_A1056)

MetaCyc: 35% identical to benzene hydroxylase alpha subunut (Geobacter metallireducens)
RXN-23213

Predicted SEED Role

"Quinone oxidoreductase (EC 1.6.5.5)" in subsystem ZZ gjo need homes (EC 1.6.5.5)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.5

Use Curated BLAST to search for 1.6.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVI8 at UniProt or InterPro

Protein Sequence (334 amino acids)

>Rru_A1056 Zinc-containing alcohol dehydrogenase superfamily (NCBI) (Rhodospirillum rubrum S1H)
MTAPLPDQMRCVEIAGAGGPEVLKMAARPLPVPGDGEVLIAVAAAGVNRPDVFQRQGSYP
PPPGASDLPGLEVAGTIVAIGAKAGEGWRIGDRVCALLSGGGYAQYASADAALCMPVPQT
LGLDEAAALPETFFTVWHNLFQRARLQEGESLLVHGGSSGIGTTAIQMAKAFGVTVYVTA
GTPEKCAACEALGADRAINYRTEDYPTVIKELTGGRGVDVVLDMVGGDYIDRDLRILAED
GRHVNIAFLQGSKVTVDLMRMMLKRLTLTGSTLRSRPATVKAGIARALEEKVWPLLEQGK
LRPPIHARFALEDAAEAHRLMERSDHIGKIVLTL