Protein Info for Rru_A1050 in Rhodospirillum rubrum S1H

Annotation: Phosphoribosylaminoimidazole carboxylase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 transmembrane" amino acids 66 to 88 (23 residues), see Phobius details amino acids 120 to 139 (20 residues), see Phobius details TIGR01162: phosphoribosylaminoimidazole carboxylase, catalytic subunit" amino acids 10 to 162 (153 residues), 199.2 bits, see alignment E=1.4e-63 PF00731: AIRC" amino acids 10 to 156 (147 residues), 199.4 bits, see alignment E=1.1e-63

Best Hits

Swiss-Prot: 66% identical to PURE_BRUME: N5-carboxyaminoimidazole ribonucleotide mutase (purE) from Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

KEGG orthology group: K01588, 5-(carboxyamino)imidazole ribonucleotide mutase [EC: 5.4.99.18] (inferred from 100% identity to rru:Rru_A1050)

MetaCyc: 57% identical to N5-carboxyaminoimidazole ribonucleotide mutase (Escherichia coli K-12 substr. MG1655)
5-(carboxyamino)imidazole ribonucleotide mutase. [EC: 5.4.99.18]

Predicted SEED Role

"Phosphoribosylaminoimidazole carboxylase catalytic subunit (EC 4.1.1.21)" in subsystem De Novo Purine Biosynthesis (EC 4.1.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.21

Use Curated BLAST to search for 4.1.1.21 or 5.4.99.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVJ4 at UniProt or InterPro

Protein Sequence (167 amino acids)

>Rru_A1050 Phosphoribosylaminoimidazole carboxylase (NCBI) (Rhodospirillum rubrum S1H)
MHTPSEAPLVGVIMGSQSDWATLRHAWDILEMLGVPAEKRIISAHRTPARLVDYATTARA
RGLRAIVAGAGGAAHLPGMVAAMTTLPVFGVPVESKALSGMDSLLSIVQMPGGVPVGTLA
IGKAGAINAGLIAASVVALSRPDIEAKLISWRDRQTAEVAEEPVDEG