Protein Info for Rru_A1050 in Rhodospirillum rubrum S1H
Annotation: Phosphoribosylaminoimidazole carboxylase (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 66% identical to PURE_BRUME: N5-carboxyaminoimidazole ribonucleotide mutase (purE) from Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)
KEGG orthology group: K01588, 5-(carboxyamino)imidazole ribonucleotide mutase [EC: 5.4.99.18] (inferred from 100% identity to rru:Rru_A1050)MetaCyc: 57% identical to N5-carboxyaminoimidazole ribonucleotide mutase (Escherichia coli K-12 substr. MG1655)
5-(carboxyamino)imidazole ribonucleotide mutase. [EC: 5.4.99.18]
Predicted SEED Role
"Phosphoribosylaminoimidazole carboxylase catalytic subunit (EC 4.1.1.21)" in subsystem De Novo Purine Biosynthesis (EC 4.1.1.21)
MetaCyc Pathways
- superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
- superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
- superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
- inosine-5'-phosphate biosynthesis I (6/6 steps found)
- inosine-5'-phosphate biosynthesis II (5/5 steps found)
- inosine-5'-phosphate biosynthesis III (5/6 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 4.1.1.21
Use Curated BLAST to search for 4.1.1.21 or 5.4.99.18
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q2RVJ4 at UniProt or InterPro
Protein Sequence (167 amino acids)
>Rru_A1050 Phosphoribosylaminoimidazole carboxylase (NCBI) (Rhodospirillum rubrum S1H) MHTPSEAPLVGVIMGSQSDWATLRHAWDILEMLGVPAEKRIISAHRTPARLVDYATTARA RGLRAIVAGAGGAAHLPGMVAAMTTLPVFGVPVESKALSGMDSLLSIVQMPGGVPVGTLA IGKAGAINAGLIAASVVALSRPDIEAKLISWRDRQTAEVAEEPVDEG