Protein Info for Rru_A1017 in Rhodospirillum rubrum S1H

Annotation: Spermidine/putrescine ABC transporter ATP-binding subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 PF00005: ABC_tran" amino acids 48 to 188 (141 residues), 132.3 bits, see alignment E=1.9e-42 TIGR01187: polyamine ABC transporter, ATP-binding protein" amino acids 61 to 386 (326 residues), 427.5 bits, see alignment E=1.6e-132 PF08402: TOBE_2" amino acids 307 to 385 (79 residues), 60.4 bits, see alignment E=1.5e-20

Best Hits

Swiss-Prot: 57% identical to POTG_ECOLI: Putrescine transport ATP-binding protein PotG (potG) from Escherichia coli (strain K12)

KEGG orthology group: K11076, putrescine transport system ATP-binding protein (inferred from 100% identity to rru:Rru_A1017)

MetaCyc: 57% identical to putrescine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"Putrescine transport ATP-binding protein PotG (TC 3.A.1.11.2)" in subsystem Polyamine Metabolism (TC 3.A.1.11.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVM7 at UniProt or InterPro

Protein Sequence (388 amino acids)

>Rru_A1017 Spermidine/putrescine ABC transporter ATP-binding subunit (NCBI) (Rhodospirillum rubrum S1H)
MADQSKAAVARSQKLPPELPGCTKKLGPPIIEIETVVKKFGDFTAVAGVSLDVFEGEFLC
LLGGSGCGKTTLLRMMAGFEQPTSGRILIDGRDMTGVPPYDRPVNMMFQSYALFPHMSVE
QNIAFGLKQDGMPKAEREARVAEMLSLVQLERFAKRKPHQLSGGQRQRVALARSLAKHPR
VLLLDEPLSALDKKLRERTQLDLVNIQEKTGITFVVVTHDQEEAMTMADRVAIMDEGWIV
QIDAPQSMYEYPNTRFVAEFFGSVNMFEGVLVEDEPDHVMIEAPELENPIYVGHGVSGHE
GATVWAALRPEKVTLVTEKPDRPYNWAAGEVKDIVYLGSTSTYIVGLDTGKRMRVTVANH
ERDVEWEITWGDRVYVSWAATSAVVVSS