Protein Info for Rru_A1008 in Rhodospirillum rubrum S1H

Annotation: ADP-ribosyl-(dinitrogen reductase) hydrolase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR02662: ADP-ribosyl-[dinitrogen reductase] hydrolase" amino acids 6 to 291 (286 residues), 524.6 bits, see alignment E=2.9e-162 PF03747: ADP_ribosyl_GH" amino acids 12 to 266 (255 residues), 225.3 bits, see alignment E=6.9e-71

Best Hits

Swiss-Prot: 100% identical to DRAG_RHORU: ADP-ribosyl-[dinitrogen reductase] glycohydrolase (draG) from Rhodospirillum rubrum

KEGG orthology group: K05521, ADP-ribosylglycohydrolase [EC: 3.2.-.-] (inferred from 100% identity to rru:Rru_A1008)

Predicted SEED Role

"ADP-ribosylglycohydrolase (EC 3.2.-.-)" (EC 3.2.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.-.-

Use Curated BLAST to search for 3.2.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVN6 at UniProt or InterPro

Protein Sequence (294 amino acids)

>Rru_A1008 ADP-ribosyl-(dinitrogen reductase) hydrolase (NCBI) (Rhodospirillum rubrum S1H)
MTGPSVHDRALGAFLGLAVGDALGATVEFMTKGEIAQQYGIHRKMTGGGWLRLKPGQITD
DTEMSLALGRSLAAKGTLDVADICEEFALWLKSRPVDVGNTCRRGIRRYMHEGTTTAPYS
EGDAGNGAAMRCLPAALATLGHPADLEPWVLAQARITHNHPLSDAACLTLGRMVHHLIGG
RGMKACREEANRLVHQHRDFHFEPYKGQSSAYIVDTMQTVLHYYFVTDTFKSCLIQTVNQ
GGDADTTGALAGMLAGATYGVDDIPSGWLSKLDMKVEREIRRQVDALLALAGLD