Protein Info for Rru_A0984 in Rhodospirillum rubrum S1H

Annotation: Peptidase M20D, amidohydrolase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 TIGR01891: amidohydrolase" amino acids 17 to 380 (364 residues), 356 bits, see alignment E=1.2e-110 PF01546: Peptidase_M20" amino acids 78 to 389 (312 residues), 141.6 bits, see alignment E=3.3e-45 PF07687: M20_dimer" amino acids 187 to 281 (95 residues), 34.9 bits, see alignment E=1.2e-12

Best Hits

KEGG orthology group: K01451, hippurate hydrolase [EC: 3.5.1.32] (inferred from 100% identity to rru:Rru_A0984)

Predicted SEED Role

"Hippurate hydrolase (EC 3.5.1.32)" (EC 3.5.1.32)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.32

Use Curated BLAST to search for 3.5.1.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVR0 at UniProt or InterPro

Protein Sequence (397 amino acids)

>Rru_A0984 Peptidase M20D, amidohydrolase (NCBI) (Rhodospirillum rubrum S1H)
MSVIPQIAAFAQELGALRHDIHAHPELGFEERRTAALVAEKLAAWGIEVHTGIGKTGVVG
VLKGRLAPGAQGARTIGLRADMDALPMDEESGCAYASTHAGRFHGCGHDGHTTMLLGAAR
YLAATRAFAGTVVFIFQPGEEGVGGAKAMLADGLFTRFPCDELYAMHNWPAQAANTVMVK
PGPAMAGSDFFDIRIKGKGSHGAMPQFSRDPIIVATALVQALQSVVSRNVAPTGAAVLSV
TQIHSGSAYNVVPDGAVISGTMRFFDAAVGDLIRQRMRALAAGLATSFGVEITVDLRPTF
TVLVNDPALSRALVEAAGDVVGGDRAMIKEDLEMGSEDFADMLRVVPGAYCTLGHSTAPE
TNKPLHNPGFVFDDAILPVGASLYARIVERRLIGQTS