Protein Info for Rru_A0976 in Rhodospirillum rubrum S1H

Annotation: Transcriptional modulator of MazE/toxin, MazF (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 PF02452: PemK_toxin" amino acids 2 to 104 (103 residues), 74.9 bits, see alignment E=2.9e-25

Best Hits

Swiss-Prot: 41% identical to MAZF_MYCS2: Probable endoribonuclease MazF (mazF) from Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)

KEGG orthology group: K07171, (no description) (inferred from 100% identity to rru:Rru_A0976)

Predicted SEED Role

"Growth inhibitor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVR8 at UniProt or InterPro

Protein Sequence (109 amino acids)

>Rru_A0976 Transcriptional modulator of MazE/toxin, MazF (NCBI) (Rhodospirillum rubrum S1H)
MKRGDLVTIAVSGDYGKPRPALVVQDDAFAALPSVTVLQLTSDVHEEHLIRITVRPDEEN
GLRKPSQIMIDRAVTLPRAKIGTVFGHVDTQTIKSVDAALGRFFGIGRQ