Protein Info for Rru_A0965 in Rhodospirillum rubrum S1H

Annotation: (2Fe-2S)-binding protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00111: Fer2
  • amino acids 7 to 60 (54 residues), 25.6 bits, E=9.7e-10
• PF01799: Fer2_2
  • amino acids 74 to 150 (77 residues), 112.8 bits, E=6.7e-37

Best Hits

Swiss-Prot: 52% identical to DCMS_HYDPS: Carbon monoxide dehydrogenase small chain (cutS) from Hydrogenophaga pseudoflava

KEGG orthology group: K03518, carbon-monoxide dehydrogenase small subunit [EC: 1.2.99.2] (inferred from 100% identity to rru:Rru_A0965)

MetaCyc: 58% identical to glycolaldehyde oxidoreductase small subunit (Saccharolobus solfataricus P2)
1.2.99.-

Predicted SEED Role

"Carbon monoxide dehydrogenase small chain (EC 1.2.99.2)" in subsystem CO Dehydrogenase (EC 1.2.99.2)

MetaCyc Pathways

• L-arabinose degradation IV (3/8 steps found)
• D-xylose degradation IV (2/7 steps found)
• superpathway of pentose and pentitol degradation (9/42 steps found)

KEGG Metabolic Maps

• Methane metabolism
• Trinitrotoluene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.2.99.2

Use Curated BLAST to search for 1.2.99.2

Sequence Analysis Tools

See Q2RVS9 at UniProt or InterPro

Protein Sequence (165 amino acids)

>Rru_A0965 (2Fe-2S)-binding protein (NCBI) (Rhodospirillum rubrum S1H)
MPMVSMTVNGEVVSGEVETRTLLVDFLRHTLGLTGTHVGCDTSQCGACVIHMNGVAVKSC
SVLTVMAEGAEILTIEGLSGNGPGDALHPMQEAFREHHGLQCGFCTPGMVMTALDLVARD
PDPDEAAIRRGLEGNICRCTGYHNIVKAVREGASRLREAGRAAAQ