Protein Info for Rru_A0965 in Rhodospirillum rubrum S1H
Annotation: (2Fe-2S)-binding protein (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 52% identical to DCMS_HYDPS: Carbon monoxide dehydrogenase small chain (cutS) from Hydrogenophaga pseudoflava
KEGG orthology group: K03518, carbon-monoxide dehydrogenase small subunit [EC: 1.2.99.2] (inferred from 100% identity to rru:Rru_A0965)MetaCyc: 58% identical to glycolaldehyde oxidoreductase small subunit (Saccharolobus solfataricus P2)
1.2.99.-
Predicted SEED Role
"Carbon monoxide dehydrogenase small chain (EC 1.2.99.2)" in subsystem CO Dehydrogenase (EC 1.2.99.2)
MetaCyc Pathways
- L-arabinose degradation IV (3/8 steps found)
- D-xylose degradation IV (2/7 steps found)
- superpathway of pentose and pentitol degradation (9/42 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 1.2.99.2
Use Curated BLAST to search for 1.2.99.2
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q2RVS9 at UniProt or InterPro
Protein Sequence (165 amino acids)
>Rru_A0965 (2Fe-2S)-binding protein (NCBI) (Rhodospirillum rubrum S1H) MPMVSMTVNGEVVSGEVETRTLLVDFLRHTLGLTGTHVGCDTSQCGACVIHMNGVAVKSC SVLTVMAEGAEILTIEGLSGNGPGDALHPMQEAFREHHGLQCGFCTPGMVMTALDLVARD PDPDEAAIRRGLEGNICRCTGYHNIVKAVREGASRLREAGRAAAQ