Protein Info for Rru_A0946 in Rhodospirillum rubrum S1H

Annotation: Cell division protein FtsQ (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details PF08478: POTRA_1" amino acids 97 to 163 (67 residues), 65 bits, see alignment E=6.2e-22 PF03799: FtsQ_DivIB_C" amino acids 167 to 282 (116 residues), 68.9 bits, see alignment E=7e-23

Best Hits

Swiss-Prot: 100% identical to FTSQ_RHORT: Cell division protein FtsQ (ftsQ) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K03589, cell division protein FtsQ (inferred from 100% identity to rru:Rru_A0946)

Predicted SEED Role

"Cell division protein FtsQ" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVU8 at UniProt or InterPro

Protein Sequence (331 amino acids)

>Rru_A0946 Cell division protein FtsQ (NCBI) (Rhodospirillum rubrum S1H)
MRRVSQPPPRPRHRRRRRRDVLPSLPRASMVFLIAGGVGMAYLAARTPALAGLIGLAPPP
ALGAPGSSVPPAGARDAGEGWGLGETARVLTRQGLVLRQVTVTGRDLTAGRDILGAIGVP
QGGPLLAIDPETVRTRLEALPWVASARVERRLPDQVHVAITEREPMALWQHNGAFAVIDR
EGRAIAADPGRWRTLPLVVGAGAPGHAAELLNLLTSQPGIAERVKAATLIGERRWTLRLD
SIENGLVVRLPEEDPSAALDQLVQIDARDHLLSKNLSVIDMRLPGRLVVRLAEDGPVDPE
AEIAGGKPARGAPAGGQKPPPIVRKSEGRDA