Protein Info for Rru_A0935 in Rhodospirillum rubrum S1H
Annotation: NAD-dependent epimerase/dehydratase (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K01710, dTDP-glucose 4,6-dehydratase [EC: 4.2.1.46] (inferred from 100% identity to rru:Rru_A0935)Predicted SEED Role
"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)
MetaCyc Pathways
- colanic acid building blocks biosynthesis (11/11 steps found)
- O-antigen building blocks biosynthesis (E. coli) (10/11 steps found)
- dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
- UDP-α-D-galactose biosynthesis (1/1 steps found)
- UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
- superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
- UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
- dTDP-4-O-demethyl-β-L-noviose biosynthesis (3/5 steps found)
- dTDP-β-D-fucofuranose biosynthesis (2/4 steps found)
- dTDP-6-deoxy-α-D-allose biosynthesis (2/4 steps found)
- dTDP-N-acetylthomosamine biosynthesis (2/4 steps found)
- dTDP-N-acetylviosamine biosynthesis (2/4 steps found)
- UDP-N-acetyl-D-galactosamine biosynthesis II (4/7 steps found)
- D-galactose detoxification (1/3 steps found)
- dTDP-L-daunosamine biosynthesis (3/6 steps found)
- dTDP-sibirosamine biosynthesis (3/6 steps found)
- D-galactose degradation I (Leloir pathway) (2/5 steps found)
- dTDP-α-D-mycaminose biosynthesis (2/5 steps found)
- dTDP-3-acetamido-α-D-fucose biosynthesis (2/5 steps found)
- dTDP-3-acetamido-3,6-dideoxy-α-D-glucose biosynthesis (2/5 steps found)
- dTDP-β-L-digitoxose biosynthesis (3/7 steps found)
- dTDP-β-L-olivose biosynthesis (3/7 steps found)
- dTDP-α-D-ravidosamine and dTDP-4-acetyl-α-D-ravidosamine biosynthesis (2/6 steps found)
- dTDP-D-desosamine biosynthesis (2/6 steps found)
- dTDP-β-L-4-epi-vancosamine biosynthesis (3/8 steps found)
- dTDP-β-L-megosamine biosynthesis (3/8 steps found)
- dTDP-β-L-mycarose biosynthesis (2/7 steps found)
- stachyose degradation (2/7 steps found)
- UDP-sugars interconversion (3/9 steps found)
- dTDP-α-D-forosamine biosynthesis (3/9 steps found)
- dTDP-α-D-olivose, dTDP-α-D-oliose and dTDP-α-D-mycarose biosynthesis (3/9 steps found)
- superpathway of enterobacterial common antigen biosynthesis (3/10 steps found)
- teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
- superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (5/19 steps found)
- superpathway of novobiocin biosynthesis (4/19 steps found)
- superpathway of erythromycin biosynthesis (2/19 steps found)
- superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
- mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)
- superpathway of megalomicin A biosynthesis (3/22 steps found)
- superpathway of dTDP-glucose-derived antibiotic building blocks biosynthesis (3/23 steps found)
KEGG Metabolic Maps
- Biosynthesis of vancomycin group antibiotics
- Galactose metabolism
- Nucleotide sugars metabolism
- Polyketide sugar unit biosynthesis
- Streptomycin biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 4.2.1.46, 5.1.3.2
Use Curated BLAST to search for 4.2.1.46 or 5.1.3.2
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q2RVV9 at UniProt or InterPro
Protein Sequence (288 amino acids)
>Rru_A0935 NAD-dependent epimerase/dehydratase (NCBI) (Rhodospirillum rubrum S1H) MNPLYGGNMHNIVDIKDKVTVNISDVRDRYSLPWLVTGKDFIFNLAGQTSHMDSMSDPFT DLEINAKSQLSLLEVCRAHCPETKIVFASTRQIYGRPQYLPVDERHPIKPVDVNGINKAA GEFYHILYSEVYGLRTTVLRLTNTYGPRMRVKDARQTFLGIWFRKLLEGQSFEVWGGDQK RDYTYIDDLVDALMISTLDPACDGKTYNIGGSEILSLRETAEMVIGNRPGATYETRVYPE DRKKIDIGDYYSDYRLFETATGWSPKVGFVEGSKRTLDYYRDNLSYYL