Protein Info for Rru_A0925 in Rhodospirillum rubrum S1H

Annotation: Glycosyl transferase, group 1 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 761 transmembrane" amino acids 543 to 564 (22 residues), see Phobius details PF13439: Glyco_transf_4" amino acids 21 to 171 (151 residues), 35 bits, see alignment E=2.3e-12 PF00534: Glycos_transf_1" amino acids 181 to 357 (177 residues), 68.3 bits, see alignment E=9.3e-23 PF13692: Glyco_trans_1_4" amino acids 192 to 345 (154 residues), 61.4 bits, see alignment E=1.8e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A0925)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RVW9 at UniProt or InterPro

Protein Sequence (761 amino acids)

>Rru_A0925 Glycosyl transferase, group 1 (NCBI) (Rhodospirillum rubrum S1H)
MTHVSRIAFIGNSLPRRCGIATFTTHLRQAVGTRFADIETFIVAMTDPGQDYAYPASVPI
EVHQDRLEDYLHAADLLNDGNVDIACLQHEFGIFGGEAGENILALLGRLTMPIVTTLHTV
LDQPTPAQRDVLDRLFALSAKLIVMAQKARELLRTVYRVPADKIEVIAHGIPDFPFVGSE
KAKAELGFSGRAVILTFGLLSPNKGIEVMIDAMPAIVKSRPDAVYVVLGATHPNLVREQG
EAYRDSLRARVQDLGLQDHVVFLDRFVDQDTLLRFISMCDIYATPYLNLAQMTSGTLAYS
FGLGKPVVSTPYWHARELLADGRGILVPFGDAGAIGLAIAGLLTDDARREAMAERAYIGS
RSMIWQRSAERYLDVFTAVLQDRQVHEAAPVERGRGARPPHAPPEMRLGHFLAMCDDTGL
FQHAVHVVPDRSHGYCVDDNARALLLACALNAPGEEPLAGALISRLAAFVQHAWNPDTKR
FRNFLSFERRWLEDRGSEDSHGRTLWALGECARSDALASRRRWAAALFTQALPSVEGFTS
PRAWAFTLLGLNAFCAAGVVDAQALRLRGLLADRLMALLGAVESADWVWFEEGLAYDNAR
LSQALIVTGRATRTPAYIEGGLRSLRWLMTIQTAPAGFFRPVGSDSFGDLRQPPKPFDQQ
ALEVAATIAACLAAWQADGDDQWRIEAMRSFDWFLGRNDLGVPLVDRETGSCRDGLHSDR
PNENRGGESVLSYLLSLAEIRRTARLGIDSATLLPLRARRL