Protein Info for Rru_A0916 in Rhodospirillum rubrum S1H

Annotation: pyruvate-formate lyase-activating enzyme (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02494: glycyl-radical enzyme activating protein
  • amino acids 12 to 296 (285 residues), 374.7 bits, E=1.5e-116
• PF13353: Fer4_12
  • amino acids 22 to 58 (37 residues), 26.3 bits, 2.9e-09
  • amino acids 105 to 185 (81 residues), 27.6 bits, E=1.1e-09
• PF04055: Radical_SAM
  • amino acids 29 to 236 (208 residues), 56.6 bits, E=1.4e-18
• PF00037: Fer4
  • amino acids 58 to 76 (19 residues), 24.2 bits, see alignment (E = 7.6e-09)
  • amino acids 84 to 99 (16 residues), 24.9 bits, see alignment (E = 4.7e-09)
• PF12838: Fer4_7
  • amino acids 60 to 103 (44 residues), 30.6 bits, 1.3e-10

Best Hits

Swiss-Prot: 40% identical to CUTD_DESAG: Choline trimethylamine-lyase activating enzyme (cutD) from Desulfovibrio alaskensis (strain G20)

KEGG orthology group: K04069, pyruvate formate lyase activating enzyme [EC: 1.97.1.4] (inferred from 100% identity to rru:Rru_A0916)

MetaCyc: 40% identical to choline trimethylamine-lyase activating enzyme (Oleidesulfovibrio alaskensis G20)
RXN-16470

Predicted SEED Role

"Pyruvate formate-lyase activating enzyme (EC 1.97.1.4)" in subsystem Fermentations: Mixed acid or Threonine anaerobic catabolism gene cluster (EC 1.97.1.4)

MetaCyc Pathways

• pyruvate fermentation to acetate IV (3/3 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (10/13 steps found)
• reductive monocarboxylic acid cycle (2/2 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
• pyruvate fermentation to ethanol I (2/3 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (6/9 steps found)
• mixed acid fermentation (11/16 steps found)
• superpathway of N-acetylneuraminate degradation (13/22 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.97.1.4

Use Curated BLAST to search for 1.97.1.4

Sequence Analysis Tools

See Q2RVX8 at UniProt or InterPro

Protein Sequence (306 amino acids)

>Rru_A0916 pyruvate-formate lyase-activating enzyme (NCBI) (Rhodospirillum rubrum S1H)
MSEIKYDQEGIVFDIQRYSIHDGPGIRTIVFLKGCPLACRWCSNPESQRFDAVLMYKKSS
CVGCGKCIEVCKAGALSFSNPEFIDRDKCVRCGACANVCLPGALTMKGKGMTVWQVMQEL
QKDAINYRRSGGGITLSGGEPLVQSAFALELLKACKDKGWSTAMETTGHAPKEVVEQVMP
FVDHALVDLKSIDPRVHESQTGVANRLILENAIRISQLSPNTVVRVPVVPGVNDNQAAIE
AIGHFAKLMHGVNTIHLLPYHTYGENKYALLGREYPMGDTKALSEKTVELLKGVVEGLGL
RCVIGG