Protein Info for Rru_A0881 in Rhodospirillum rubrum S1H

Annotation: ABC transporter component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 589 transmembrane" amino acids 22 to 48 (27 residues), see Phobius details amino acids 59 to 82 (24 residues), see Phobius details amino acids 146 to 175 (30 residues), see Phobius details amino acids 246 to 268 (23 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details PF00664: ABC_membrane" amino acids 26 to 212 (187 residues), 51 bits, see alignment E=1.7e-17 PF00005: ABC_tran" amino acids 354 to 504 (151 residues), 107.2 bits, see alignment E=1.1e-34

Best Hits

KEGG orthology group: K06021, phosphate-transporting ATPase [EC: 3.6.3.27] (inferred from 100% identity to rru:Rru_A0881)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.27

Use Curated BLAST to search for 3.6.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RW13 at UniProt or InterPro

Protein Sequence (589 amino acids)

>Rru_A0881 ABC transporter component (NCBI) (Rhodospirillum rubrum S1H)
MTADEGGAGRLLALTAGRRGRFIGACLLASLGAALGLAPFFLAAWIVGEGETLSAGHTPA
LAVALIASLVTAPLAHGLATALAHDGAFDVLAELRERLVAKMLRLPLDTLTRVPAGSMKR
MMTDDVETLELFLSHQLPDMVACISVPTLTVIALMVIDWRLALACLAVVPFLVWVQRRTL
QGHGQRIGVYFRKIGEVNAAAVEFVRGIEEIRHARSGGLVAEVLRRRVEDFKAFAQEWYR
LWGPPWSLYCVLVGAAPLAVIPLVLVFYTQGDMSFPVLVVGLFVATGIGGPLAKLPIYGE
ITHQVNGAEKRIRDMLARPEVSGGSGGMLAGSAPIGEAARFFGVSLSLGESEVLEDVSFS
VPQGRLTAIVGPSGAGKSSILRLLNRSWDPTAGRIHLGGIDLSSLAVDQLSRHVALVSQE
AFLFDDTVAANIRAGRPEATDEEVRAAAGQALCASFIEKALPESYETRLGEGGQRLSGGQ
RQRLALARALLAGSPLLLLDEATSFLDARHEADLQKAIQAIIGPKTVVVVSHRLDSTRQA
DHIVFVQAGRVMGEGGHERLLDRCPDYARLWDLQRRNLEWRFSTGENNR