Protein Info for Rru_A0848 in Rhodospirillum rubrum S1H

Annotation: Major facilitator superfamily MFS_1 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 46 to 66 (21 residues), see Phobius details amino acids 87 to 110 (24 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 220 to 243 (24 residues), see Phobius details amino acids 255 to 275 (21 residues), see Phobius details amino acids 281 to 301 (21 residues), see Phobius details amino acids 313 to 333 (21 residues), see Phobius details amino acids 375 to 397 (23 residues), see Phobius details TIGR02718: siderophore transporter, RhtX/FptX family" amino acids 9 to 398 (390 residues), 560.7 bits, see alignment E=8.2e-173 PF13000: Acatn" amino acids 14 to 93 (80 residues), 61.6 bits, see alignment E=5.8e-21 PF07690: MFS_1" amino acids 15 to 364 (350 residues), 54.4 bits, see alignment E=1e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A0848)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RW46 at UniProt or InterPro

Protein Sequence (413 amino acids)

>Rru_A0848 Major facilitator superfamily MFS_1 (NCBI) (Rhodospirillum rubrum S1H)
MLELLRHRRLVVTLALLYVSQGLPIGIAMDALPTLLRHDGASLRALAFLPLVGLPWVVKF
LWASWVDNHWTARLGRRRSWILPMQGVVLACLLGLALVGVGVASAGWVVGLMAVASLASA
TQDIATDGMAAEHFAGDLLTKVNAIQVAGVMIGFFAGGAGNLILVGHFGQTIAFLTLFCV
PLASLVFVGLLPPDAPRGRADAAPAGASLWGFIRRPMAPSLLLLALLSAMTAVSGFGLSK
LFLTDAGWALEDIGRLGMSGGMITILLGCGGGVWLVKRIGLWRGFGVGVFFAGVSGCLWS
LQAVQWLSVTEGVVWVCIVLGSLSTGITSVAILTEAMRLAGQGDQAGTDITAVQSTRDLG
ELLASSSLVAVTARLGYGGAFLGGCLLAILALTVALRLRRRERRATMATAEEF