Protein Info for Rru_A0847 in Rhodospirillum rubrum S1H

Annotation: PepSY-associated TM helix (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 173 to 200 (28 residues), see Phobius details amino acids 340 to 361 (22 residues), see Phobius details amino acids 381 to 401 (21 residues), see Phobius details amino acids 413 to 429 (17 residues), see Phobius details amino acids 437 to 457 (21 residues), see Phobius details amino acids 463 to 484 (22 residues), see Phobius details PF03929: PepSY_TM" amino acids 11 to 362 (352 residues), 113.3 bits, see alignment E=1.1e-36

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A0847)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RW47 at UniProt or InterPro

Protein Sequence (505 amino acids)

>Rru_A0847 PepSY-associated TM helix (NCBI) (Rhodospirillum rubrum S1H)
MKPAFRRLLAEVHGGAGAVLGVLLFVVLFSGCWSLGAEALQTWARPPLADGGGAGLSIGE
LLDRARERGMAVDDVSLTLPVSEGEGIGFCQGRGPCSLSLDPLTGLPLPERAALTILKDL
HKSAFLGFPGRILVSLFGIALFIVCVSGLVLLGRRWRLPWSPRRTHGARAGVLDWHGVIG
SWIFPWLMLFALTGALSGLGALGTVTLSRVAYPGQPSQVFADLLGPPPPAASGRPLVGGL
DLERILERDARDFPQFTARRVKISHGEDDAATIEIGGITRGLPSTALFESHLYRVADGTL
LAARSATDHGPWTRAFIAVQPLHFADYAWVGGGWSSWLRGLHLTTGVLACLLCAGGLHLW
GLRRQAVATWSCVVVPRLVEGVCGGLVVASGALLCFVQAIPPASAGEDGAGRLFWWVWGG
VLLLSVLPLRRRSFLSPYLGLAGGACLLAVGLHVRAWLGAGSWSSLAVDLTLLLCGALFC
RLSWGLARSSAPHPPLPGRIGDQNA