Protein Info for Rru_A0844 in Rhodospirillum rubrum S1H

Annotation: ABC transporter component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 569 transmembrane" amino acids 22 to 43 (22 residues), see Phobius details amino acids 55 to 76 (22 residues), see Phobius details amino acids 130 to 149 (20 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details amino acids 238 to 261 (24 residues), see Phobius details amino acids 270 to 287 (18 residues), see Phobius details PF00005: ABC_tran" amino acids 345 to 494 (150 residues), 92.4 bits, see alignment E=3.9e-30

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to rru:Rru_A0844)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RW50 at UniProt or InterPro

Protein Sequence (569 amino acids)

>Rru_A0844 ABC transporter component (NCBI) (Rhodospirillum rubrum S1H)
MKTLLDRFRSLPVDCRYEIRQAALWAGGAAVLDAACGLLLVPLLETWVTEGEVPWRWLSF
LVAATVLHALILYLAARRGYLAGGRLAFGLVRRLVSHLPRLAPPALRKVAAPEGLLRGPV
LQSMGMPAHLLGPLVSAVVTPTCVVLGLFFLDGRIAAALLLAGLLLAILMRWSGRRTLED
EAARAGAERAFARQIQTFAQHQALLRASGRAGPARRDLERALEDLQASTRRLLARGLPVG
LAFSLAVQALCLLGLLGGAWMVTHQSLDGARLLALLVLLARFIEPLTQLTPLDQALRGSA
RALDTVLRVLSLPPLESPERGEQPRDCGLRAEALGWDADDGRALLTDISLTLDPGTLSVI
VGPTGAGKSSLLALLGRLHDPDRGAVFLGGVDARKLDEKTLAARRNLVFQESGLFHGTVA
WNLRMARTDASPADLRSAAELASLLDDIERWPDGWETEVGPGGALLSGGQRQRLCLARAF
LSPAPLLLLDEPTASLDAFSERRVIHSLAASRGSRTVLVVTHNPAVARMADQVLVLDKGR
LRLRGRHDALSRRDDWYARFAGGAVTCEV