Protein Info for Rru_A0795 in Rhodospirillum rubrum S1H

Annotation: Nitrogenase iron protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 PF00142: Fer4_NifH" amino acids 6 to 267 (262 residues), 334.8 bits, see alignment E=8.3e-104 TIGR01287: nitrogenase iron protein" amino acids 6 to 275 (270 residues), 407.9 bits, see alignment E=9.6e-127 PF13614: AAA_31" amino acids 7 to 52 (46 residues), 32.9 bits, see alignment 1.2e-11 PF01656: CbiA" amino acids 9 to 226 (218 residues), 50.1 bits, see alignment E=5.5e-17

Best Hits

Swiss-Prot: 78% identical to NIFH2_PAEDU: Nitrogenase iron protein 2 (nifH2) from Paenibacillus durus

KEGG orthology group: K02588, nitrogenase iron protein NifH [EC: 1.18.6.1] (inferred from 100% identity to rru:Rru_A0795)

MetaCyc: 100% identical to methylthio-alkane reductase reductase component (Rhodospirillum rubrum)
1.18.98.M1 [EC: 1.18.98.M1]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.18.6.1

Use Curated BLAST to search for 1.18.6.1 or 1.18.98.M1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RW96 at UniProt or InterPro

Protein Sequence (291 amino acids)

>Rru_A0795 Nitrogenase iron protein (NCBI) (Rhodospirillum rubrum S1H)
MAKSPKQIAIYGKGGIGKSTTTSNISAALAEAGYKVMQFGCDPKSDSTNTLRGGDYIPSV
LDLLRENARVDAHEAIFQGFGGIYCVEAGGPAPGVGCAGRGIITAVELLKQQNVFEELDL
DYVIFDVLGDVVCGGFAVPIREGIAEHVFTVSSSDFMAIYAANNLFKGIQKYSNAGGALL
GGVIANSINTDFHRDIIDDFVARTQTQVVQYVPRSLTVTQAELQGRTTIEAAPESAQAEI
YRTLARSIADHTDSKVPTPLNAQELRDWSASWANQLIEIERASQPIPALAS