Protein Info for Rru_A0768 in Rhodospirillum rubrum S1H

Annotation: Binding-protein-dependent transport systems inner membrane component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 558 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 54 to 80 (27 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 187 to 209 (23 residues), see Phobius details amino acids 242 to 264 (23 residues), see Phobius details amino acids 285 to 311 (27 residues), see Phobius details amino acids 332 to 355 (24 residues), see Phobius details amino acids 373 to 393 (21 residues), see Phobius details amino acids 411 to 434 (24 residues), see Phobius details amino acids 463 to 484 (22 residues), see Phobius details amino acids 521 to 542 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 70 to 263 (194 residues), 37.7 bits, see alignment E=9.2e-14 amino acids 347 to 538 (192 residues), 36.4 bits, see alignment E=2.4e-13

Best Hits

KEGG orthology group: K02011, iron(III) transport system permease protein (inferred from 100% identity to rru:Rru_A0768)

Predicted SEED Role

"Ferric iron ABC transporter, permease protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWC3 at UniProt or InterPro

Protein Sequence (558 amino acids)

>Rru_A0768 Binding-protein-dependent transport systems inner membrane component (NCBI) (Rhodospirillum rubrum S1H)
MIRLRSVASPWTLGSALIASIVAVAPLSVLVLALTPEGEAIWGHLASTVLPGYLINTALL
LLGVGLGTLVIGTGCAWLVTLYRFPGRRLFEWALLLPLAVPAFILGFTYTELLDYAGPVQ
ATLRALAGWSSPRDYWFPEVRSLGGAILLMSLVLYPYVYLLARAAFLEQSLCTLEVSRTL
GCTPLAAFFRVALPLARPSLVVGVALALMEALNDYGTVKLFNVHTLTSGLYNVWLIMGNR
QGAAQIACVLLTFVVALIIAERLARAKRAYHGAGGRSRPIEGRPLNGLAGGAALIACALP
VVLGFGVPAAVLLRNTLVRLPEAIDGPLLGYARASLTLSTLAAAIALALGLFLAYAGRLD
PSPLTRWLGRLSGLGYALPGTVLAIGLLVPFGAFDNALDGWMRAHFGLSTGLLLSGSLFA
LVFAYVVRFLALSFGAAESGLARVRPSLDSAARSLGCRPAQVLARVHLPLIKGSLLTAAL
LVFVDSMKELPASLLLRPFNVETLATHVFQFASSEQIERAAPGALAIVVTGLIPVIVLSR
AIAQARSWRGTPGETPSQ