Protein Info for Rru_A0751 in Rhodospirillum rubrum S1H

Annotation: Modification methylase HemK (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF17827: PrmC_N
  • amino acids 28 to 97 (70 residues), 68.1 bits, E=2e-22
• TIGR00536: methyltransferase, HemK family
  • amino acids 42 to 301 (260 residues), 173.2 bits, E=6.3e-55
• TIGR03534: protein-(glutamine-N5) methyltransferase, release factor-specific
  • amino acids 47 to 296 (250 residues), 253.3 bits, E=2.4e-79
• PF05175: MTS
  • amino acids 133 to 211 (79 residues), 39.7 bits, E=1e-13
• PF06325: PrmA
  • amino acids 135 to 207 (73 residues), 24.2 bits, E=5.7e-09
• PF13847: Methyltransf_31
  • amino acids 135 to 217 (83 residues), 36.9 bits, E=7.3e-13
• PF13649: Methyltransf_25
  • amino acids 137 to 225 (89 residues), 29.8 bits, E=2.1e-10

Best Hits

Swiss-Prot: 100% identical to PRMC_RHORT: Release factor glutamine methyltransferase (prmC) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K02493, methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to rru:Rru_A0751)

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2"

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See Q2RWE0 at UniProt or InterPro

Protein Sequence (325 amino acids)

>Rru_A0751 Modification methylase HemK (NCBI) (Rhodospirillum rubrum S1H)
MSDGDGGGEQGGGGPAEAEESALVLGRLLDRGAWRLKVAGVEKPRRDARLLAGHVLGLSP
GAVLLADDRVVTPEEAQALEAVIARRETREPVSRILGHRGFWRFDLALGADTLDPRPDTE
TLVEAGLAVLEGCGGRILDLGTGSGCILLALLADRPGAIGLGIDIAPGAVRVALRNARAL
GLERRALFAVGDWAAAVAGPFDLIVSNPPYIPSADIAALEPEVARFDPSRALDGGADGLD
PYRILAAQVPALLAPAGVLAVEFGQGQARDVAGLLEVGGLCPYEIKKDLSGEERCLLARR
RAAGPLPPIHIDAKPSAPGNGPTKA