Protein Info for Rru_A0742 in Rhodospirillum rubrum S1H

Annotation: Ubiquinone biosynthesis O-methyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 TIGR01983: 3-demethylubiquinone-9 3-O-methyltransferase" amino acids 13 to 241 (229 residues), 264.5 bits, see alignment E=3.3e-83 PF13489: Methyltransf_23" amino acids 59 to 216 (158 residues), 70.6 bits, see alignment E=3.3e-23 PF13847: Methyltransf_31" amino acids 64 to 184 (121 residues), 37.8 bits, see alignment E=4e-13 PF13649: Methyltransf_25" amino acids 69 to 160 (92 residues), 56.7 bits, see alignment E=8.1e-19 PF08241: Methyltransf_11" amino acids 69 to 161 (93 residues), 65.4 bits, see alignment E=1.6e-21 PF08242: Methyltransf_12" amino acids 69 to 161 (93 residues), 48.1 bits, see alignment E=4e-16

Best Hits

Swiss-Prot: 100% identical to UBIG_RHORT: Ubiquinone biosynthesis O-methyltransferase (ubiG) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K00568, 3-demethylubiquinone-9 3-methyltransferase [EC: 2.1.1.- 2.1.1.64] (inferred from 100% identity to rru:Rru_A0742)

MetaCyc: 55% identical to 2-polyprenyl-6-hydroxyphenol methylase (Cereibacter sphaeroides)
3-demethylubiquinone-9 3-O-methyltransferase. [EC: 2.1.1.64]; RXN-9233 [EC: 2.1.1.64, 2.1.1.222]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 2.1.1.64

Use Curated BLAST to search for 2.1.1.- or 2.1.1.222 or 2.1.1.64

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWE9 at UniProt or InterPro

Protein Sequence (249 amino acids)

>Rru_A0742 Ubiquinone biosynthesis O-methyltransferase (NCBI) (Rhodospirillum rubrum S1H)
MSATTSGTASAAELAKFSAMADAWWDPEGDFKPLHKFNPVRIAFLRDHFAAHFGRDIEAP
RPFEGLSLLDIGCGGGLLCEPFARLGFAVTGIDAAERNIGTASVHAERAGLPLTYRCAMP
EDLVAEGKTFDAVLTMEVVEHVADVRLFLDSVGQLCRPGGAVGAATLNRTLKSLALAKVG
AEYVLRWLPRGTHDWRKFMKPSELTAGLREAGLSVDAIAGMTFDPFSGTWSQTTDVSVNY
MLFATRAAA