Protein Info for Rru_A0725 in Rhodospirillum rubrum S1H

Annotation: Cyclopropane-fatty-acyl-phospholipid synthase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF02353: CMAS" amino acids 141 to 409 (269 residues), 295.9 bits, see alignment E=9.6e-92 PF13489: Methyltransf_23" amino acids 187 to 318 (132 residues), 55.4 bits, see alignment E=2.3e-18 PF13847: Methyltransf_31" amino acids 199 to 306 (108 residues), 35.1 bits, see alignment E=4e-12 PF13649: Methyltransf_25" amino acids 204 to 298 (95 residues), 58.9 bits, see alignment E=2.4e-19 PF08241: Methyltransf_11" amino acids 205 to 301 (97 residues), 45.7 bits, see alignment E=2.9e-15 PF08242: Methyltransf_12" amino acids 205 to 299 (95 residues), 44 bits, see alignment E=1.1e-14

Best Hits

KEGG orthology group: K00574, cyclopropane-fatty-acyl-phospholipid synthase [EC: 2.1.1.79] (inferred from 100% identity to rru:Rru_A0725)

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.79

Use Curated BLAST to search for 2.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWG6 at UniProt or InterPro

Protein Sequence (427 amino acids)

>Rru_A0725 Cyclopropane-fatty-acyl-phospholipid synthase (NCBI) (Rhodospirillum rubrum S1H)
MLTKKTASALVLAMSTLLPGLGPAQPWSRALARLAEGLRLGRLTVVFPDGTQRVISGRDG
DAGGRGVLILRSDAAARALFLGGDTGFAEAYMDGLWDSPDLTALIGLAAVNQRALGTNDF
GGLGPVRLLDRLRHRLRRNSKRGAKRNIAYHYDLGNAFYQGWLDPSMTYSSALFEGESES
LEAAQTRKYQRLAALLSLEPGMRVLEIGCGWGGFAELAARDYGVEVVGITLSQEQLSWGR
ERIRRAGLEGKVDLRLQDYRDVTGQFDRVVSIEMFEAVGQDHWPIYFESLRARLKPGGLA
ALQVITIAADRFEDYRSGADFIQKHIFPGGMLPSVPRLLEAIDKAGLVGAEVQRFGLSYA
RTLDLWQRAFQHAWPRLAGETGFSDRFRRMWEYYFAYCQAGFTEGIIDVGFYTAQRPDED
PRAPTDR