Protein Info for Rru_A0722 in Rhodospirillum rubrum S1H

Annotation: Sigma-24 (FecI) (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 44 to 198 (155 residues), 97.6 bits, see alignment E=2.9e-32 PF04542: Sigma70_r2" amino acids 48 to 116 (69 residues), 73 bits, see alignment E=2.7e-24 PF08281: Sigma70_r4_2" amino acids 146 to 196 (51 residues), 50.1 bits, see alignment E=3.4e-17 PF07638: Sigma70_ECF" amino acids 149 to 198 (50 residues), 23.1 bits, see alignment E=1.2e-08 PF04545: Sigma70_r4" amino acids 150 to 198 (49 residues), 54 bits, see alignment E=1.9e-18

Best Hits

Swiss-Prot: 51% identical to RPOE_RHOS4: ECF RNA polymerase sigma factor RpoE (rpoE) from Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 100% identity to rru:Rru_A0722)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWG9 at UniProt or InterPro

Protein Sequence (206 amino acids)

>Rru_A0722 Sigma-24 (FecI) (NCBI) (Rhodospirillum rubrum S1H)
MPSPTAPGSTATPASPAPPPSPAADGADHGALIVAIARSGDRAAFATLFTHYAPRLKSYL
RRLGANDASAEEVAQEALLMVWRKAERFDPTKAGAATWIFTIARNLRIDMLRKERRPEID
PEDPLLEPSSPDAADILIEKDQRETRVRTALRSLPADQAEVVRLAFFEDLTHVEVADRLG
LPLGTVKSRLRLAFSKVRGSVGDEVR