Protein Info for Rru_A0706 in Rhodospirillum rubrum S1H

Annotation: RarD protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 54 to 72 (19 residues), see Phobius details amino acids 84 to 104 (21 residues), see Phobius details amino acids 116 to 133 (18 residues), see Phobius details amino acids 140 to 157 (18 residues), see Phobius details amino acids 163 to 179 (17 residues), see Phobius details amino acids 191 to 209 (19 residues), see Phobius details amino acids 227 to 246 (20 residues), see Phobius details amino acids 256 to 274 (19 residues), see Phobius details amino acids 280 to 299 (20 residues), see Phobius details PF00892: EamA" amino acids 20 to 155 (136 residues), 42.1 bits, see alignment E=5.4e-15 amino acids 167 to 297 (131 residues), 30.8 bits, see alignment E=1.7e-11 TIGR00688: protein RarD" amino acids 21 to 272 (252 residues), 188.9 bits, see alignment E=5.9e-60

Best Hits

KEGG orthology group: K05786, chloramphenicol-sensitive protein RarD (inferred from 100% identity to rru:Rru_A0706)

Predicted SEED Role

"Protein rarD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWI5 at UniProt or InterPro

Protein Sequence (310 amino acids)

>Rru_A0706 RarD protein (NCBI) (Rhodospirillum rubrum S1H)
MNAPMASPSLSPSPAGSSARGVAAALGAYGVWGISPLFFKAVSEVSALEILSHRVLWAMV
VMGITLGLRGELAASLRFLANRRVFLLMLAATVAISINWLTFIHAATSGHAMQGSLGYYI
FPLVTVVLGRLVLGEEMSRRQGLAVALAAAGVGIALWRTGSLPWISLTLASTFALYGLIR
KTVSVPPLAGLFIEALLLSPVLIGLLAWIELKGGGLAFFDGPWGRSLWLMALGPLTAVPL
FFFTWAARRLRLSTLGVIQYTNPTIQFALAALVFKEPVTTTELLTFGFIWAGVALYLWPV
RKDPPAQEYP