Protein Info for Rru_A0704 in Rhodospirillum rubrum S1H

Annotation: Molybdenum ABC transporter, periplasmic binding protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF13531: SBP_bac_11" amino acids 29 to 255 (227 residues), 178.6 bits, see alignment E=1.7e-56 TIGR01256: molybdate ABC transporter, periplasmic molybdate-binding protein" amino acids 34 to 253 (220 residues), 224.8 bits, see alignment E=6.2e-71 PF01547: SBP_bac_1" amino acids 35 to 246 (212 residues), 59.6 bits, see alignment E=5.3e-20

Best Hits

Swiss-Prot: 54% identical to MODA_ECOLI: Molybdate-binding protein ModA (modA) from Escherichia coli (strain K12)

KEGG orthology group: K02020, molybdate transport system substrate-binding protein (inferred from 100% identity to rru:Rru_A0704)

MetaCyc: 54% identical to molybdate ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]

Predicted SEED Role

"Molybdenum ABC transporter, periplasmic molybdenum-binding protein ModA (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWI7 at UniProt or InterPro

Protein Sequence (258 amino acids)

>Rru_A0704 Molybdenum ABC transporter, periplasmic binding protein (NCBI) (Rhodospirillum rubrum S1H)
MHIGSLRGLLAAGSLALVLAAPAAQAEELTVFAAASTTNALTDIIALFNDTGAGPAVASF
ASSSTLAKQIEQGAPAGVFLSADQKWMDYLDEKGLIAKDSRADLLGNRLALIAPANSTLK
VAEVSSKTDFPALLGEGRLAVGDPDHVPVGIYTKEAFTKLGLWDGVANKLAPANDVRGAL
TFVERGESPLGVVYSTDSAVSEKVKTLALLPESSHKPVTYPVATVKAKDTKTARAFVDFL
KGAKAKAVFERYGFQVKP