Protein Info for Rru_A0666 in Rhodospirillum rubrum S1H

Annotation: Multi-sensor Signal Transduction Histidine Kinase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 579 transmembrane" amino acids 93 to 114 (22 residues), see Phobius details amino acids 265 to 289 (25 residues), see Phobius details PF05227: CHASE3" amino acids 123 to 257 (135 residues), 115.3 bits, see alignment E=3.2e-37 PF02518: HATPase_c" amino acids 460 to 569 (110 residues), 96.3 bits, see alignment E=2.3e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A0666)

Predicted SEED Role

"COG0642: Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWM5 at UniProt or InterPro

Protein Sequence (579 amino acids)

>Rru_A0666 Multi-sensor Signal Transduction Histidine Kinase (NCBI) (Rhodospirillum rubrum S1H)
MTRQLLRDGTRGTRRWRERPLSPLPRAAPPAPPDAFGKRRFPGTRREGTAFGSGLQRGRG
APVPPPPRRPPIPPAAKARHPMPSLTPASTKVTAPLLLAAFAGLALLLFATVWLGNRTQI
YATSFDQTQEIYMRATRTFRGLQDAETGQRGYLLTHDPAYLQPYHDALSRMSEQRRLMNA
LIQDTPWESGLGAKLTPLIDAKLAELARTVDLAQAGRWDEALALVLAGSGKTTMDQARTV
LEDTLAELRSALQTQSEEMKTRSAYLFWAVTFGGLFILCVAGTAFWLIVRANSSLAQAQA
QLRSLNESLESRVRGRTQEVQRANEEIQRFAYIVSHDLRSPLVNVMGFTAELEAGLKDLQ
ARHPIETGDGALSEDERDLRVTIFEDMPEAVGFIRSSTAKMDGLINAILRLSREGRRTIS
PERLDMTALVESVVSTTTHSIQDTGSTVSVDKNLPEIVSDRLALSQIFANLIDNAIKYRL
PGRPCAVTITGRIDRGRALFQVADTGRGIEPKDHERIFDLFRRSGEQDQPGEGIGLAHVR
TLVRRLGGEITVGSVPGQGTTFHITLPFDVGPYLEIEPS