Protein Info for Rru_A0661 in Rhodospirillum rubrum S1H

Annotation: Hly-III related proteins (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 transmembrane" amino acids 19 to 38 (20 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 135 to 154 (20 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 191 to 209 (19 residues), see Phobius details PF03006: HlyIII" amino acids 18 to 204 (187 residues), 99.1 bits, see alignment E=1.6e-32

Best Hits

Swiss-Prot: 36% identical to HLY3_BACSU: Hemolysin-3 homolog (yplQ) from Bacillus subtilis (strain 168)

KEGG orthology group: K11068, hemolysin III (inferred from 100% identity to rru:Rru_A0661)

Predicted SEED Role

"COG1272: Predicted membrane protein hemolysin III homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWN0 at UniProt or InterPro

Protein Sequence (212 amino acids)

>Rru_A0661 Hly-III related proteins (NCBI) (Rhodospirillum rubrum S1H)
MSGSLFPTYTRAERIADAAIHMLGVPLGLIAAVWLVIAGWDGGRTTTASAIYGLGLVGML
SASAAYNLASHGTLKHILRRIDHAMIFVMIAGTYTPFALLGLGGEMGGWLCGAIWTTAVL
GVASKLLLPYGWERLSLVLYLAMGWAILTVIGPLSDALSMPAIVLVFIGGILYTIGTAFH
SFKRLPFQNAFWHLLVLAAAACHFASIYYEFV