Protein Info for Rru_A0659 in Rhodospirillum rubrum S1H

Annotation: Putative diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with Response Regulator Receiver modulation (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 766 PF11849: DUF3369" amino acids 147 to 322 (176 residues), 153.8 bits, see alignment E=7.7e-49 PF00990: GGDEF" amino acids 326 to 475 (150 residues), 60.5 bits, see alignment E=2.6e-20 PF00563: EAL" amino acids 506 to 731 (226 residues), 220.2 bits, see alignment E=4e-69

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A0659)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWN2 at UniProt or InterPro

Protein Sequence (766 amino acids)

>Rru_A0659 Putative diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with Response Regulator Receiver modulation (NCBI) (Rhodospirillum rubrum S1H)
MTPNEDLIEIFEDEEISPSLTAKTWPILIVDDDQDVHDVSRLALRGVRLLDYDLETLHAY
SAAQARAILSSRSDIAVALLDVVMEREDAGLDLVRWIRSDPARDLLRIVLRTGQPGYAPE
ATVIQDYDINDYRTKSELNRGRLISILTTALRSYRQMAVIAASRDGLDKIVRASADLLAS
PSMAIFAEGVLTQLAGLLGTERSGIVLARRNRRPGATASMAMTGDEGFVLAAAGPLSADI
GRPLSDIGDHQTAEILRRTLESRRSSFDHGSMALYIATPNGDSLAVLMEVAKTLGDTDRK
LVEVFCVNMAAGFDTISLFEQISLQAFHDEATGLPNLAACQSLIDQYLQRRQPVAVTFFS
LEGFSAISDTLGRVIGDRMIGLLANAFRHRLQERGEVFRVGQETLATVIGGPVDQVGPLA
DQLAGDFRAGLPLDSMTLPVSFSHGTSVSTSEHDTAQILVQRAGIAMQKARNIKRGGGLT
YAVAMEEEIRAHIGVISKLGAGVVSEAFVAVFQPKIRLADRSCHGGEALVRWRDGDGTMI
APSLFIPAAETSGHIVDIGYSVFRQSCAMIRSLKVSQDDARIAVNLSVRQMREPDLIDKL
VSIAAEEGVATTRLKLEITESIVIDDLTHTVSLLKALKDKGFLLALDDFGTGYSSLSYLR
SLPIDTLKIDRSFVSGLAEQADMRKIVGLIIGLGHELGFDITAEGVETEEEARIVTEMGC
FTAQGYLFSKPLSAEDFLVFARTHAGARQTSGGSLSAEGCIRARDA