Protein Info for Rru_A0657 in Rhodospirillum rubrum S1H

Annotation: Lysine exporter protein (LYSE/YGGA) (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 37 to 60 (24 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details amino acids 180 to 201 (22 residues), see Phobius details PF01810: LysE" amino acids 14 to 201 (188 residues), 126.7 bits, see alignment E=4.2e-41

Best Hits

Swiss-Prot: 44% identical to Y1986_MYCTU: Putative amino-acid transporter Rv1986 (Rv1986) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K06895, L-lysine exporter family protein LysE/ArgO (inferred from 100% identity to rru:Rru_A0657)

Predicted SEED Role

"Transporter, LysE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWN4 at UniProt or InterPro

Protein Sequence (203 amino acids)

>Rru_A0657 Lysine exporter protein (LYSE/YGGA) (NCBI) (Rhodospirillum rubrum S1H)
MSVSVFFAGLTMGLSLIVAIGAQNAFVLRQGLRNEHVLAISLTCALSDALLITLGVAGFG
KMMALAPWLDPLLRYGGAAFLIWYGAISLRSALRSSAALAVGPAAEKAGLKATLLTCLAL
TWLNPHVYLDTVMLLGSISTQFPDRQGSFAAGAMAASFLFFFALGYGSSWLKPLFAKPSA
WRSLEAIIALVMWTIALKLLVGS