Protein Info for Rru_A0655 in Rhodospirillum rubrum S1H

Annotation: Transcriptional Regulator, AsnC family (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 PF13412: HTH_24" amino acids 45 to 91 (47 residues), 63.4 bits, see alignment E=1.8e-21 PF13404: HTH_AsnC-type" amino acids 45 to 86 (42 residues), 62.9 bits, see alignment 2.9e-21 PF01037: AsnC_trans_reg" amino acids 111 to 184 (74 residues), 81.2 bits, see alignment E=6.2e-27

Best Hits

Swiss-Prot: 53% identical to LRP_SERMA: Leucine-responsive regulatory protein (lrp) from Serratia marcescens

KEGG orthology group: K03719, Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein (inferred from 100% identity to rru:Rru_A0655)

Predicted SEED Role

"PutR, transcriptional activator of PutA and PutP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWN6 at UniProt or InterPro

Protein Sequence (196 amino acids)

>Rru_A0655 Transcriptional Regulator, AsnC family (NCBI) (Rhodospirillum rubrum S1H)
MAPAGPSTRSFGDFPEEVSLILRRKQAERLYYQLFGGKRTGMASLDRIDRRILRELQADG
RLSIVELARRVHLTKTPCAERVHRLEREGVIHGYQARLDPQVLGADHVAFVQVSLKGTTE
AELEQFNAAVRGLPEVQSCHMIAGGFDYLLKVRTRDIAEYRHVLGEKISRLPVVQQTHTY
VVMESVKDETTLPVRD