Protein Info for Rru_A0654 in Rhodospirillum rubrum S1H

Annotation: Multiple antibiotic resistance (MarC)-related proteins (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 52 to 72 (21 residues), see Phobius details amino acids 78 to 96 (19 residues), see Phobius details amino acids 119 to 141 (23 residues), see Phobius details amino acids 151 to 177 (27 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details PF01914: MarC" amino acids 13 to 212 (200 residues), 176.7 bits, see alignment E=2.1e-56 TIGR00427: membrane protein, MarC family" amino acids 15 to 210 (196 residues), 147 bits, see alignment E=3e-47

Best Hits

KEGG orthology group: K05595, multiple antibiotic resistance protein (inferred from 100% identity to rru:Rru_A0654)

Predicted SEED Role

"Multiple antibiotic resistance protein MarC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWN7 at UniProt or InterPro

Protein Sequence (217 amino acids)

>Rru_A0654 Multiple antibiotic resistance (MarC)-related proteins (NCBI) (Rhodospirillum rubrum S1H)
MDYFGLAAKYIPFVTLGLLPIMNPLSTVPLFLELTKRMSPERKHQQARRACLYALSILAV
FLFIGNGIITLFGISLAGIRVAGGLIILVLAFRMLFSGEGEEASIETEATEIKRANLDFS
FSPLAMPSLAGPGSIAVVMSYGSQIPDDALVFGHFIVICGISITVLIAYIALAGSAWIAK
FLGEHGIQAVTKIMGFLLTCIAVQFIASGIRDFSQTL