Protein Info for Rru_A0641 in Rhodospirillum rubrum S1H

Annotation: Prolipoprotein diacylglyceryl transferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 60 to 82 (23 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 179 to 197 (19 residues), see Phobius details amino acids 209 to 227 (19 residues), see Phobius details amino acids 234 to 261 (28 residues), see Phobius details TIGR00544: prolipoprotein diacylglyceryl transferase" amino acids 7 to 266 (260 residues), 242.8 bits, see alignment E=2.4e-76 PF01790: LGT" amino acids 12 to 260 (249 residues), 273.1 bits, see alignment E=9.4e-86

Best Hits

Swiss-Prot: 100% identical to LGT_RHORT: Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (lgt) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K13292, phosphatidylglycerol:prolipoprotein diacylglycerol transferase [EC: 2.-.-.-] (inferred from 100% identity to rru:Rru_A0641)

Predicted SEED Role

"Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-)" (EC 2.4.99.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.-.-.-

Use Curated BLAST to search for 2.-.-.- or 2.4.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWQ0 at UniProt or InterPro

Protein Sequence (274 amino acids)

>Rru_A0641 Prolipoprotein diacylglyceryl transferase (NCBI) (Rhodospirillum rubrum S1H)
MLFALPFPAIDPVLVEIGPFAIRWYALAYIVGLLGGWWYTRFLSRRSRPPVMSDADVDDL
LVWATLGTILGGRLGYVVFYNAAHFLANPLEIPMLWHGGMSFHGGLVGVITATVLFCRSR
RLSVARVGDLVALVAPLGLFFGRLANFINGELFGRPAPDVPWAMVFPHGGPLPRHPSQLY
EATLEGLVLFCLLGLLWRFTALSRKPGQIIGLFLIGYGLSRITAEFFREPDAQIGFLALG
VTMGQILSLPMILAGIVVFVVARRAKPLAVPGGR