Protein Info for Rru_A0640 in Rhodospirillum rubrum S1H

Annotation: ABC-2 transporter component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 transmembrane" amino acids 38 to 61 (24 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 121 to 146 (26 residues), see Phobius details amino acids 153 to 178 (26 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details amino acids 214 to 232 (19 residues), see Phobius details amino acids 239 to 262 (24 residues), see Phobius details PF01061: ABC2_membrane" amino acids 25 to 232 (208 residues), 103.9 bits, see alignment E=4.5e-34

Best Hits

Swiss-Prot: 36% identical to YADH_SHIFL: Inner membrane transport permease YadH (yadH) from Shigella flexneri

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 100% identity to rru:Rru_A0640)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWQ1 at UniProt or InterPro

Protein Sequence (270 amino acids)

>Rru_A0640 ABC-2 transporter component (NCBI) (Rhodospirillum rubrum S1H)
MKDASAGFSIPQPRHIGAVNWLGLWELYLKEVRRFLKVYLQTLAAPLVTTLIFLAIFALS
VGPQTAQGGLGFMEFLAPGLIMMAMVQNAFANTSSSLIIAKVQGNIVDVLMPPLNATELT
LAYALGGVTRGVMVGIFVALGMMAFVTLHIHSVFFIVYHAFAASLMLSLLGMIAGIWADK
FDHMASVTNFIVTPLSFLSGTFYTIDRLPESLRFLAHLNPFFYMIDGFRFGFIGHDQAMP
ITGLVVVGGFNVVLAAVCWQMFRTGYKLKA