Protein Info for Rru_A0639 in Rhodospirillum rubrum S1H

Annotation: Regulatory protein RecX (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 PF02631: RecX_HTH2" amino acids 78 to 118 (41 residues), 31 bits, see alignment 1.2e-11

Best Hits

Swiss-Prot: 42% identical to RECX_MYXXD: Regulatory protein RecX (recX) from Myxococcus xanthus (strain DK 1622)

KEGG orthology group: K03565, regulatory protein (inferred from 100% identity to rru:Rru_A0639)

Predicted SEED Role

"Regulatory protein recX"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWQ2 at UniProt or InterPro

Protein Sequence (198 amino acids)

>Rru_A0639 Regulatory protein RecX (NCBI) (Rhodospirillum rubrum S1H)
MATDYSQGRPVAKPVTPARLERIALFYLERFPASTEGLRRVLMRRVERSVRAHDTDRAQA
ATWVEAVLTRLQASGLLDDRVFAEGKARALFRRGDPPGLIRRALTARGVGTEAIDAALAE
VLEHSEDPEHEAALAYCRRRRLGPFRLDPASRPANHRKDLAALARHGFSRAVALRVLDLD
DDGAGGEGGLTITPSFWA