Protein Info for Rru_A0601 in Rhodospirillum rubrum S1H

Annotation: Phosphate transport system permease protein 1 (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 TIGR00972: phosphate ABC transporter, ATP-binding protein" amino acids 1 to 248 (248 residues), 407.8 bits, see alignment E=7.3e-127 PF00005: ABC_tran" amino acids 17 to 172 (156 residues), 108.3 bits, see alignment E=5e-35

Best Hits

Swiss-Prot: 100% identical to PSTB_RHORT: Phosphate import ATP-binding protein PstB (pstB) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K02036, phosphate transport system ATP-binding protein [EC: 3.6.3.27] (inferred from 100% identity to rru:Rru_A0601)

MetaCyc: 56% identical to phosphate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-27-RXN [EC: 7.3.2.1]; 7.3.2.1 [EC: 7.3.2.1]

Predicted SEED Role

"Phosphate transport ATP-binding protein PstB (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.27

Use Curated BLAST to search for 3.6.3.27 or 7.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWU0 at UniProt or InterPro

Protein Sequence (248 amino acids)

>Rru_A0601 Phosphate transport system permease protein 1 (NCBI) (Rhodospirillum rubrum S1H)
MAVNDVNVFYGAKQAIKNVGLDIVAREVTAFIGPSGCGKSTFLRCLNRMNDTIDICKVTG
DIRLDGEDVYDRHIDVVELRARVGMVFQKPNPFPKSIYENIAYGPRIHGIARGKSELDEI
VQSSLERAGLWEEVKDRLESPGTGLSGGQQQRVCIARAIAVSPEVILMDEPCSALDPIAT
AKIEELIDELRSNYTIVIVTHSMQQAARVSQRTAFFHLGRLIECGDTETIFTNPQHNLTQ
GYITGRFG