Protein Info for Rru_A0577 in Rhodospirillum rubrum S1H

Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 TIGR00147: lipid kinase, YegS/Rv2252/BmrU family" amino acids 18 to 320 (303 residues), 141 bits, see alignment E=2e-45 PF00781: DAGK_cat" amino acids 19 to 141 (123 residues), 97.5 bits, see alignment E=4.6e-32 PF19279: YegS_C" amino acids 160 to 310 (151 residues), 62.3 bits, see alignment E=5e-21

Best Hits

KEGG orthology group: K07029, (no description) (inferred from 100% identity to rru:Rru_A0577)

Predicted SEED Role

"Transcription regulator [contains diacylglycerol kinase catalytic domain]"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWW4 at UniProt or InterPro

Protein Sequence (323 amino acids)

>Rru_A0577 hypothetical protein (NCBI) (Rhodospirillum rubrum S1H)
MRVLPFAPANPAPAPAQRRVMIIANPAAGSLKQRRLNRTLLGLEKLGCTVGLRETAKPGD
ATLMAREAALAGNVDVVVAAGGDGTINEVANGLAGSGVALGVIPLGTANVLAIEAGIPRD
PGKAAQVIATGVLRKLYLGEVRASAETPLAGPRRFVMMAGAGFDAHVVDTVDLALKRKTG
KLAYVWCTVQRAFSYDFPLCAVDIDTPDGRTIHADVATAVVCNGKYYGGPFIAAPLADIS
HPTFQVILLKSPGLRHVARYALALAMGRLPRLPDVEIIEATRVRIALQGAQPLQADGDTV
AHMPVDIVMAAEPVSLIVPAPAA