Protein Info for Rru_A0563 in Rhodospirillum rubrum S1H

Annotation: Twin-arginine translocation pathway signal (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 signal peptide" amino acids 1 to 45 (45 residues), see Phobius details PF13458: Peripla_BP_6" amino acids 63 to 388 (326 residues), 226.6 bits, see alignment E=1.1e-70 PF13433: Peripla_BP_5" amino acids 65 to 393 (329 residues), 80.1 bits, see alignment E=2.6e-26 PF01094: ANF_receptor" amino acids 71 to 221 (151 residues), 46.4 bits, see alignment E=4.4e-16

Best Hits

KEGG orthology group: K01999, branched-chain amino acid transport system substrate-binding protein (inferred from 100% identity to rru:Rru_A0563)

Predicted SEED Role

"Glycosyltransferase (EC 2.4.1.-)" (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWX8 at UniProt or InterPro

Protein Sequence (421 amino acids)

>Rru_A0563 Twin-arginine translocation pathway signal (NCBI) (Rhodospirillum rubrum S1H)
MNKQPAARTALKKPASGVGRRAFLAGSAAGILGLAAPAIRRAQAAEAIRIGEINSYSQIP
AFTLPYRNGWQLAVEQINAAGGLLGGRPLEVISRDDGGDPGKAVTAAQELLTRHGVHALA
GTFLSHVGLAVSDFARQRKVLFMASEPLTDALTWEKGNRYTYRLRPSTYMQAAMLAAEAA
KLPITRWATIAPNYEYGQSAVARFKELLLAARPEVTFVAEQWPALYKLDAGPTVQALQQA
EPEGLFNVLFGADLPKFVREGRVRGLFAGRQVVSMLTGEPEYLNPLKDEAPEGWIVTGYP
WYDIDTAPHRAFVEAYRARWKEDPFVGSLVGYNTLTAMAVAFEKAGGTESETLVETLKDM
AFSTPMGPLSFRASDHQSTMGAWVGRTALRDGKGVMVDWRYVDGGSVLPPPEVVSAWRPA
G