Protein Info for Rru_A0561 in Rhodospirillum rubrum S1H

Annotation: Cytochrome bd ubiquinol oxidase, subunit II (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 7 to 37 (31 residues), see Phobius details amino acids 68 to 69 (2 residues), see Phobius details amino acids 75 to 76 (2 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 113 to 139 (27 residues), see Phobius details amino acids 157 to 180 (24 residues), see Phobius details amino acids 192 to 216 (25 residues), see Phobius details amino acids 228 to 249 (22 residues), see Phobius details amino acids 256 to 275 (20 residues), see Phobius details amino acids 295 to 320 (26 residues), see Phobius details PF02322: Cyt_bd_oxida_II" amino acids 5 to 322 (318 residues), 327.6 bits, see alignment E=4.2e-102 TIGR00203: cytochrome d ubiquinol oxidase, subunit II" amino acids 6 to 211 (206 residues), 155.5 bits, see alignment E=1.2e-49

Best Hits

KEGG orthology group: K00426, cytochrome bd-I oxidase subunit II [EC: 1.10.3.-] (inferred from 100% identity to rru:Rru_A0561)

MetaCyc: 51% identical to cyanide insensitive ubiquinol oxidase subunit II (Pseudomonas putida KT2440)
RXN-6883 [EC: 1.10.3.11]

Predicted SEED Role

"putative Cytochrome bd2, subunit II" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 1.10.3.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RWY0 at UniProt or InterPro

Protein Sequence (333 amino acids)

>Rru_A0561 Cytochrome bd ubiquinol oxidase, subunit II (NCBI) (Rhodospirillum rubrum S1H)
MSIDLPLIWGMLIAFAVFAYVVLDGFDLGIGILFPFLGGEDERNRAMNSIAPVWDGNETW
LVLGGGGLFAAFPEAYSVLMTAFYAPVIAMLLALVFRGVAFEFRFMAKRGKRFWTAGFFA
GSLMAALCQGMMLGAFVQGIAFEDGRYAGGWFDWFSPFSLLTGAAVVCGYSLLGAGWLAI
KTDGPLADFAFRIARLAGVVTLVAIVAVSALTPLVAPLAAERWFGPQMLWHAPAPIAVVV
LGAVLLRAIARRRELTLFLSGLGLFATCYIGFALSKYPYIIPDHVTFRAAAADEAALAFL
LPGALVLIPIILGYTAYAYWVFRGKTGHEGYGH