Protein Info for Rru_A0539 in Rhodospirillum rubrum S1H

Annotation: Flagellar biosynthesis protein FlhA (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 720 transmembrane" amino acids 39 to 60 (22 residues), see Phobius details amino acids 66 to 88 (23 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 140 to 163 (24 residues), see Phobius details amino acids 232 to 253 (22 residues), see Phobius details amino acids 273 to 292 (20 residues), see Phobius details amino acids 308 to 327 (20 residues), see Phobius details amino acids 333 to 350 (18 residues), see Phobius details TIGR01398: flagellar biosynthesis protein FlhA" amino acids 44 to 720 (677 residues), 901.9 bits, see alignment E=1.3e-275 PF00771: FHIPEP" amino acids 54 to 712 (659 residues), 867 bits, see alignment E=5.1e-265

Best Hits

KEGG orthology group: K02400, flagellar biosynthesis protein FlhA (inferred from 100% identity to rru:Rru_A0539)

Predicted SEED Role

"Flagellar biosynthesis protein FlhA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RX02 at UniProt or InterPro

Protein Sequence (720 amino acids)

>Rru_A0539 Flagellar biosynthesis protein FlhA (NCBI) (Rhodospirillum rubrum S1H)
MAEDLNQGRLTPLPVNGPGTPDGPPPFAFGAWARRMRELVVTGEFALPFGLIAILVVLIL
PMPTWLLDIMLAMSLTLSVLILMTVVFIRKALEFSTFPMVLLITTMLRLALNLASTRLIL
AQGHEGTAAAGHVIEAFGGFIMGGNFVIGVIVFSILVLVNFMVITKGATRIAEVTARFTL
DAMPGKQMAIDADLSSGLIDETEARRRREEMQKESDFFGAMDGASKFVRGDAIAGIIITF
INVIGGMIIGIAQNDLTFSEAANTYTALTVGDGLVSQIPALIISVAAGVMVSKGGLTTTA
ETALIGQFTAYPKALGMSAFLAGALALVPGTPALPFLLLAGLTGGAAWWLNRKASNIKRD
EAEHAQELATQEIPVAEEPISTALKIDLVRLELGYGLLSLINTAHNQRLTDQIKALRRAL
ATDMGFVMPPVRIQDNMQLAANTYRIYIKEVEAGHGDLRPTMLLVMDPRGDEITLAGEKT
HEPTFGLPAVWVDLSNREEAMFRGYTVVDPPTVITTHITEVVKDHMAELLSYAETQKLLD
DLDKEQQKLIADMIPTQISTSGVQRVLQNLLAERVSIRDLPTILEGVAEACGATRNIMMI
TEHVRTRIARQLSDANVNEDGIVPLVTLSPQWETAFAEALIGQGEDRQLSMAPSKLQEFI
VGVRQTFERFAMQGESPVLLTSPMIRPYVRSIIERFRPMTVVMSQNEIHPKAKIKTLGQI