Protein Info for Rru_A0532 in Rhodospirillum rubrum S1H

Annotation: Cobyrinic acid a,c-diamide synthase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF10609: ParA" amino acids 12 to 58 (47 residues), 37.9 bits, see alignment 2.7e-13 PF13614: AAA_31" amino acids 14 to 170 (157 residues), 48.2 bits, see alignment E=2.5e-16 PF06564: CBP_BcsQ" amino acids 15 to 253 (239 residues), 28.4 bits, see alignment E=2.4e-10 PF01656: CbiA" amino acids 16 to 233 (218 residues), 63.7 bits, see alignment E=3.3e-21

Best Hits

KEGG orthology group: K04562, flagellar biosynthesis protein FlhG (inferred from 100% identity to rru:Rru_A0532)

Predicted SEED Role

"Flagellar synthesis regulator FleN" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RX09 at UniProt or InterPro

Protein Sequence (257 amino acids)

>Rru_A0532 Cobyrinic acid a,c-diamide synthase (NCBI) (Rhodospirillum rubrum S1H)
MAPRATGLMARTRNIIAIASGKGGVGKTWFSITLAHALAKRGCRALLFDGDLGLANVDIQ
LGLMPNHDLGSVMSGKKTLNQAATAYPAGNFDVIAGRSGSGSLANIPPGRLQILVEDLML
MSQSYDKVIIDLGAGVDKSVRLLSRAAGSMLVVTSDEPTSLTDAYALIKITAMERRDLDI
RVVVNACNSTREGERTYQTLLKACQGFLKISPPLAGIVRRDTRVRESIRNQTPILTRFPS
SEAAMDVEAIAERLLQG