Protein Info for Rru_A0526 in Rhodospirillum rubrum S1H

Annotation: ATPase FliI/YscN (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 475 TIGR01026: ATPase, FliI/YscN family" amino acids 5 to 436 (432 residues), 519.4 bits, see alignment E=7.2e-160 TIGR03498: flagellar protein export ATPase FliI" amino acids 22 to 438 (417 residues), 674.3 bits, see alignment E=5.9e-207 PF00006: ATP-synt_ab" amino acids 148 to 359 (212 residues), 294.7 bits, see alignment E=4.1e-92 PF18269: T3SS_ATPase_C" amino acids 368 to 436 (69 residues), 68.1 bits, see alignment E=5e-23

Best Hits

Swiss-Prot: 59% identical to FLII_CAUVC: Flagellum-specific ATP synthase (fliI) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K02412, flagellum-specific ATP synthase [EC: 3.6.3.14] (inferred from 100% identity to rru:Rru_A0526)

Predicted SEED Role

"Flagellum-specific ATP synthase FliI" in subsystem Flagellar motility or Flagellum

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RX15 at UniProt or InterPro

Protein Sequence (475 amino acids)

>Rru_A0526 ATPase FliI/YscN (NCBI) (Rhodospirillum rubrum S1H)
MSAIFSNLLNDLAKLPERRIFGRVVGVQGMLVEIGGAQTNLSVGDRCAVIARDGRPITCE
VIGFRAARALLMPFSVLDGVGLGCRAEVIEGVPAIYPTRDWLGRVINAMGEAVDGKGALP
AGERAVAIRGRPPSAHSRQRVGGKLDLGVRAINTFLTCCRGQRMGIFAGSGVGKSSVMSM
FIRNTNADVIVMGLVGERGREAREFIEDDLGEEGLKRAVTVVATSDESPLMRRQAAYMTL
AVAEYFRDQGLDVLCLMDSVTRFAMAQREISLSAGEPPASKGYTPTVFAELPKLLERAGP
GVEGSGSITGLFTVLVEGDDHNEPISDAVRGILDGHIVLDRAIAERGRYPAINILRSVSR
TMPGCNSPAENALVAKGRRLMAAYENMAELIRLGAYRKGSDPETDTAIHYHPALDAFLTQ
AKTEGTDLATGYAMLEAALAPQIEMSPPPMAAKGFPAPSRSFQPSRSPAPPRKRD