Protein Info for Rru_A0515 in Rhodospirillum rubrum S1H

Annotation: HAD-superfamily subfamily IIA hydrolase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR01459: HAD hydrolase, TIGR01459 family" amino acids 15 to 254 (240 residues), 179.4 bits, see alignment E=8.2e-57 TIGR01460: HAD hydrolase, family IIA" amino acids 24 to 256 (233 residues), 119.2 bits, see alignment E=2.5e-38 PF13344: Hydrolase_6" amino acids 24 to 129 (106 residues), 66 bits, see alignment E=5.5e-22 PF00702: Hydrolase" amino acids 152 to 247 (96 residues), 47.4 bits, see alignment E=6.3e-16 PF13419: HAD_2" amino acids 197 to 253 (57 residues), 25.7 bits, see alignment E=2.4e-09 PF13242: Hydrolase_like" amino acids 206 to 260 (55 residues), 42.9 bits, see alignment E=7.5e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to rru:Rru_A0515)

Predicted SEED Role

"HAD superfamily protein involved in N-acetyl-glucosamine catabolism"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RX26 at UniProt or InterPro

Protein Sequence (295 amino acids)

>Rru_A0515 HAD-superfamily subfamily IIA hydrolase (NCBI) (Rhodospirillum rubrum S1H)
MTSPVAAPFFAPGLSAFAKEYDAFIIDLWGVIHDGTQAYPGAAAALAALKAQGKRTVLLT
NAPRLSGSVIAQMEGLGLGRALYDAVMTSGDAVNAELLRRDDPFFQGLGQACLFVGPERD
TNVLTDTGVALVTDPAKAGFVLCTGPVSFDESVADYAALLEACAAQGLPMVCANPDRAVV
REGKTVICAGALADFYAGLGQTVVSRGKPDPAIYRLALERLDLPAGARVAAIGDGVHTDM
PGARAAGVDAVFVTGGLNAELLGIRHGEAPDQAKVRALLDAHALTPKMAIPAFVW