Protein Info for Rru_A0487 in Rhodospirillum rubrum S1H

Annotation: Alpha/beta hydrolase fold (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 transmembrane" amino acids 153 to 167 (15 residues), see Phobius details TIGR03056: putative magnesium chelatase accessory protein" amino acids 16 to 301 (286 residues), 499.5 bits, see alignment E=1e-154 PF00561: Abhydrolase_1" amino acids 52 to 289 (238 residues), 75.4 bits, see alignment E=1.2e-24 PF12146: Hydrolase_4" amino acids 53 to 288 (236 residues), 50.6 bits, see alignment E=3.3e-17 PF12697: Abhydrolase_6" amino acids 54 to 293 (240 residues), 89.6 bits, see alignment E=1e-28

Best Hits

KEGG orthology group: K06049, magnesium chelatase accessory protein (inferred from 100% identity to rru:Rru_A0487)

Predicted SEED Role

"COG0596: Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RX53 at UniProt or InterPro

Protein Sequence (310 amino acids)

>Rru_A0487 Alpha/beta hydrolase fold (NCBI) (Rhodospirillum rubrum S1H)
MMCVGGKMIWEREGKTWPHRDCSRFVTVGGFHWHVQSMGPTAGGNGKGGDAPLLLLVHGT
AATTHSWRDLMGPLARSFRVVAIDLPGHGFTRAPFSFRPTLPSMAKALSALLAAEGLSPD
GVVGHSAGAAILARMVLDGSVTPRMLVSINGAFMPFPGMAGTLFPYMARVLFCNPLTPYM
MSWGAADQQRVERLIRDTGSLLDKPGMTYYGRLMRSPAHVSSALSMMAHWDLAPLNRDMR
RLTIPLHLIVGEEDKAVSPDEAKRLATRVATATLHVVPGGGHLVHEEQPDLVVGLIEQAA
REVALLPPLS