Protein Info for Rru_A0470 in Rhodospirillum rubrum S1H

Annotation: Cell shape determining protein MreB/Mrl (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 TIGR00904: cell shape determining protein, MreB/Mrl family" amino acids 6 to 335 (330 residues), 524.8 bits, see alignment E=4.3e-162 PF06723: MreB_Mbl" amino acids 7 to 334 (328 residues), 504.8 bits, see alignment E=2.1e-155 PF00022: Actin" amino acids 32 to 198 (167 residues), 42.6 bits, see alignment E=8.2e-15 PF00012: HSP70" amino acids 103 to 323 (221 residues), 47 bits, see alignment E=3e-16 PF14450: FtsA" amino acids 155 to 314 (160 residues), 50.2 bits, see alignment E=8.7e-17

Best Hits

Swiss-Prot: 74% identical to MREB_CAUVN: Cell shape-determining protein MreB (mreB) from Caulobacter vibrioides (strain NA1000 / CB15N)

KEGG orthology group: K03569, rod shape-determining protein MreB and related proteins (inferred from 100% identity to rru:Rru_A0470)

Predicted SEED Role

"Rod shape-determining protein MreB" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RX70 at UniProt or InterPro

Protein Sequence (342 amino acids)

>Rru_A0470 Cell shape determining protein MreB/Mrl (NCBI) (Rhodospirillum rubrum S1H)
MTGLLSADMAIDLGTANTLVYVKGRGIVLNEPSVVAIADVKGKKQVLAVGDEAKQMLGRT
PGNIQAIRPLRDGVIADFEVAEEMIKHFIRKVHNRRSFASPMVIICVPSGSTAVERRAIQ
ESAEAAGARRVFLIEEPMAAAIGAGLPVTEPTGSMVVDIGGGTTEVAVLSLGGIVYARSV
RVGGDKMDEAIIAYIRRNHNLLVGEGSAERIKKEIGCACPPEDGSNRTIEIKGRDLMNGV
PKELVISEAQIAESLAEPVSAIIEAVKVALEHTAPELAADIVDKGIVLTGGGALLTNLDY
VLRASTGLPVSIADDPLSCVAMGTGRALEEMKRLRNVLTTMY