Protein Info for Rru_A0465 in Rhodospirillum rubrum S1H

Annotation: Phosphoserine phosphatase SerB (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 TIGR00338: phosphoserine phosphatase SerB" amino acids 79 to 286 (208 residues), 195 bits, see alignment E=1.3e-61 TIGR01488: HAD phosphoserine phosphatase-like hydrolase, family IB" amino acids 86 to 255 (170 residues), 97.7 bits, see alignment E=7.8e-32 PF00702: Hydrolase" amino acids 87 to 258 (172 residues), 60.1 bits, see alignment E=6.1e-20 PF12710: HAD" amino acids 88 to 253 (166 residues), 82.4 bits, see alignment E=8.9e-27 PF08282: Hydrolase_3" amino acids 217 to 263 (47 residues), 28.5 bits, see alignment 2e-10

Best Hits

KEGG orthology group: K01079, phosphoserine phosphatase [EC: 3.1.3.3] (inferred from 100% identity to rru:Rru_A0465)

Predicted SEED Role

"Phosphoserine phosphatase (EC 3.1.3.3)" in subsystem Glycine and Serine Utilization or Serine Biosynthesis (EC 3.1.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RX75 at UniProt or InterPro

Protein Sequence (299 amino acids)

>Rru_A0465 Phosphoserine phosphatase SerB (NCBI) (Rhodospirillum rubrum S1H)
MDVVVTVLSSPAVGGLDEEALAAARAALDTLGGETARPRWLESGVAADIRVDALSVGQAG
SAVRHALADVACDVVAQREDGRRKGLLIADMDSTMVIGETLDDLAAHAGLKDKIAAITAR
AMNGEIDFEAALRERVGMLAGLSASALEETWAATALTPGGRTLVRTMAANGARCVLVSGG
FSVFTAKVAKACGFHDHVANRLEIIDGALSGKVIDPVVDRAVKLATLKAEAAKLGLPLSA
CAAVGDGANDLPMVMAAGLGVAFHAKPVVAAQTRARIDHGDLTALLFLQGYRREEFIED