Protein Info for Rru_A0432 in Rhodospirillum rubrum S1H

Annotation: 4-hydroxythreonine-4-phosphate dehydrogenase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 TIGR00557: 4-hydroxythreonine-4-phosphate dehydrogenase PdxA" amino acids 11 to 338 (328 residues), 390.9 bits, see alignment E=2.6e-121 PF04166: PdxA" amino acids 44 to 334 (291 residues), 327.9 bits, see alignment E=3e-102

Best Hits

Swiss-Prot: 58% identical to PDXA_RHOPA: 4-hydroxythreonine-4-phosphate dehydrogenase (pdxA) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K00097, 4-hydroxythreonine-4-phosphate dehydrogenase [EC: 1.1.1.262] (inferred from 100% identity to rru:Rru_A0432)

Predicted SEED Role

"4-hydroxythreonine-4-phosphate dehydrogenase (EC 1.1.1.262)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.1.1.262)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.262

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXA8 at UniProt or InterPro

Protein Sequence (344 amino acids)

>Rru_A0432 4-hydroxythreonine-4-phosphate dehydrogenase (NCBI) (Rhodospirillum rubrum S1H)
MSPSPAPSAPLVLTMGDPAGVGGETALMAWAARTAGQGLPPFVMIGDVDWLAALSRRLGL
GPVRAVDSLEEGPGVFDQALPVLVEPLAVPAQAGKGDPANGRAVIAAIERAVALVAAGRA
AGVVTLPINKHVLKQAGFGHPGHTEFLGALAARHWPDLPAHPVMMLACPDLKVVPVTVHL
ALREAIDTLDEATIVACATIVAQALTRDFAIAAPRLALAGLNPHAGESGAMGREDITIIA
PAVARLRAGGIDARGPLPADTLFHAEARAGYDVALGMYHDQVLIPIKTLDFHGGVNVTLG
LPFVRTSPDHGTAFDIAGRGLARPDSLIAALRLAAGMASRRSAS