Protein Info for Rru_A0397 in Rhodospirillum rubrum S1H

Annotation: Argininosuccinate lyase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00838: argininosuccinate lyase
  • amino acids 18 to 470 (453 residues), 601 bits, E=8.2e-185
• PF00206: Lyase_1
  • amino acids 21 to 315 (295 residues), 262.4 bits, E=6.6e-82
• PF14698: ASL_C2
  • amino acids 378 to 446 (69 residues), 86.5 bits, E=1.3e-28

Best Hits

Swiss-Prot: 100% identical to ARLY_RHORT: Argininosuccinate lyase (argH) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01755, argininosuccinate lyase [EC: 4.3.2.1] (inferred from 100% identity to rru:Rru_A0397)

Predicted SEED Role

"Argininosuccinate lyase (EC 4.3.2.1)" in subsystem Arginine Biosynthesis extended (EC 4.3.2.1)

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• superpathway of arginine and polyamine biosynthesis (14/17 steps found)
• L-arginine biosynthesis I (via L-ornithine) (8/9 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (7/9 steps found)
• nitric oxide biosynthesis II (mammals) (2/3 steps found)
• urea cycle (3/5 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• canavanine biosynthesis (2/4 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.2.1

Sequence Analysis Tools

See Q2RXE3 at UniProt or InterPro

Protein Sequence (478 amino acids)

>Rru_A0397 Argininosuccinate lyase (NCBI) (Rhodospirillum rubrum S1H)
MSSSTPTTPSIERTASTIWGGRFDSGPSAVMEAINASIGFDKRLYRQDIAGSKAHCTMLV
ATGILSKADGEAILGGLDRILAEIEAGDFPFSVALEDIHMNIESRLKDLIGEAAGRLHTA
RSRNDQVATDFRLWVRDAIDGVEGALARLQDVLITRAEEHADTVMPGFTHLQAAQPVTFG
HHLLAYVEMIGRDRGRFHDARVRLNESPLGSAALAGTSFPIDRAMTAQILGFDRPCANSL
DGVSDRDFALEFLAAASIASIHLSRLAEELVIWTSAQFGFVRLPDAYSTGSSIMPQKRNP
DAAELVRAKAGRVIGDLASLLIVMKGLPLAYSKDMQDDKEPVFEAADTLELCIAAMTGMM
ETITPKVDRLRTAAGQGFTTATDLADWLVRALGTPFRHAHEVSGALVKMAEKKGVGLEDL
SLAEMRTIEPRLTDEAIKVLSVDWSVRSRTSFGGTAPDNVRAACAAARARYAAKAPPR