Protein Info for Rru_A0379 in Rhodospirillum rubrum S1H

Annotation: Flavodoxin, long chain (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 TIGR01752: flavodoxin" amino acids 3 to 160 (158 residues), 184.4 bits, see alignment E=6.3e-59 PF00258: Flavodoxin_1" amino acids 5 to 155 (151 residues), 72.3 bits, see alignment E=4.7e-24 PF12724: Flavodoxin_5" amino acids 5 to 82 (78 residues), 30 bits, see alignment E=6.3e-11

Best Hits

Swiss-Prot: 45% identical to FLAV_SYNP2: Flavodoxin (isiB) from Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)

KEGG orthology group: K03839, flavodoxin I (inferred from 100% identity to rru:Rru_A0379)

MetaCyc: 45% identical to flavodoxin A (Salmonella enterica enterica serovar Typhimurium)
Cob(I)yrinic acid a,c-diamide adenosyltransferase. [EC: 2.5.1.17]

Predicted SEED Role

"Flavodoxin 1" in subsystem Flavodoxin

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.17

Use Curated BLAST to search for 2.5.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXG1 at UniProt or InterPro

Protein Sequence (160 amino acids)

>Rru_A0379 Flavodoxin, long chain (NCBI) (Rhodospirillum rubrum S1H)
MGTTVIYGSDGGTTQGVAKRIASPLQAKVVDIKVATTDDLEGCDLLILGAPTYGLGDLQC
DWESRIGVLDSAKLTGKRVALFGTGDQIGYPDSFVDAMGILYDRVVALGATVVGFTATQG
YDYSYSLAERDGQFVGLALDEDNQSSLTGKRIAAWVDHLK