Protein Info for Rru_A0375 in Rhodospirillum rubrum S1H

Annotation: Pirin-like (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 PF02678: Pirin" amino acids 12 to 118 (107 residues), 111.9 bits, see alignment E=1.5e-36 PF17954: Pirin_C_2" amino acids 153 to 230 (78 residues), 53.3 bits, see alignment E=2.5e-18

Best Hits

Swiss-Prot: 56% identical to Y1473_CAUVC: Pirin-like protein CC_1473 (CC_1473) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: K06911, (no description) (inferred from 100% identity to rru:Rru_A0375)

Predicted SEED Role

"Pirin domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXG5 at UniProt or InterPro

Protein Sequence (231 amino acids)

>Rru_A0375 Pirin-like (NCBI) (Rhodospirillum rubrum S1H)
MIELRPFASLGTLDIDWLTARYHFSFSRYYDPARMGLGSLRVWNDDQVRAGTGFEPHSHR
DMEIITYVRKGAITHEDNLGNKGRTAAGDVQVMWAGSGITHAEYNRESEDTLLFQIWIET
ARPGIAPGWEARAFPKEPGQVIALASGRDLPDHAGALPLHQDAAILGGVLTPGQTLTLPS
KGRKLYIVPTTGALRVGDHTARARDGVAIWDEAEITLTALEETEVVIADVA