Protein Info for Rru_A0360 in Rhodospirillum rubrum S1H

Annotation: Initiation factor 2B alpha/beta/delta (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to MTNA_RHORT: Methylthioribose-1-phosphate isomerase (mtnA) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K08963, methylthioribose-1-phosphate isomerase [EC: 5.3.1.23] (inferred from 100% identity to rru:Rru_A0360)

MetaCyc: 100% identical to methylthioribose-1-phosphate isomerase (Rhodospirillum rubrum)
S-methyl-5-thioribose-1-phosphate isomerase. [EC: 5.3.1.23]; 5.3.1.23 [EC: 5.3.1.23]

Predicted SEED Role

"Methylthioribose-1-phosphate isomerase (EC 5.3.1.23)" in subsystem Methionine Salvage (EC 5.3.1.23)

MetaCyc Pathways

5'-deoxyadenosine degradation I (3/3 steps found)
S-methyl-5-thio-α-D-ribose 1-phosphate degradation II (4/5 steps found)
S-methyl-5-thio-α-D-ribose 1-phosphate degradation III (4/5 steps found)
5'-deoxyadenosine degradation II (3/4 steps found)
L-methionine salvage cycle III (6/11 steps found)
L-methionine salvage cycle I (bacteria and plants) (6/12 steps found)
S-methyl-5-thio-α-D-ribose 1-phosphate degradation I (2/7 steps found)
L-methionine salvage cycle II (plants) (4/11 steps found)

KEGG Metabolic Maps

Methionine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q2RXI0 at UniProt or InterPro

Protein Sequence (390 amino acids)

>Rru_A0360 Initiation factor 2B alpha/beta/delta (NCBI) (Rhodospirillum rubrum S1H)
MNVKGTPTRTIWPAREGGAVWIIDQTRLPHEFVTQRLNDLGAVAHAIRAMLVRGAPLIGA
TAAYGVALGMAEDPSDEGLTRACQTLLATRPTAVNLRWAIEAMAESLAAVPPDQRAQAAW
AKAGAICDEDVALNEAIGDHGLGIIKDLARTKGVEKGGEGPINILTHCNAGWLATVDWGT
ALAPLYKAHDAGLPIHVWVDETRPRNQGASLTAWELNSHGVPHTVIADNTGGHLMQHGLV
DMVIVGTDRTTATGDVCNKIGTYLKALAAFDNAVPFYVALPGPTIDWTVNDGLREIPIEQ
RDAAEVTRVWGRTAAGALEWVTITPTGSPAANYAFDVTPARLITGLITERGVCAASAAGL
AGLYPERAPAPVPAGSAAGKGAAATADGAL