Protein Info for Rru_A0356 in Rhodospirillum rubrum S1H

Annotation: Isocitrate dehydrogenase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00127: isocitrate dehydrogenase, NADP-dependent
  • amino acids 2 to 404 (403 residues), 702.8 bits, E=5.3e-216
• PF00180: Iso_dh
  • amino acids 6 to 391 (386 residues), 210.2 bits, E=2.7e-66

Best Hits

Swiss-Prot: 80% identical to IDH_SPHYA: Isocitrate dehydrogenase [NADP] (icd) from Sphingobium yanoikuyae

KEGG orthology group: K00031, isocitrate dehydrogenase [EC: 1.1.1.42] (inferred from 100% identity to rru:Rru_A0356)

MetaCyc: 70% identical to isocitrate dehydrogenase subunit (Mycobacterium tuberculosis H37Rv)
Isocitrate dehydrogenase (NADP(+)). [EC: 1.1.1.42]

Predicted SEED Role

"Isocitrate dehydrogenase [NADP] (EC 1.1.1.42)" in subsystem TCA Cycle (EC 1.1.1.42)

MetaCyc Pathways

• TCA cycle V (2-oxoglutarate synthase) (9/9 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (8/9 steps found)
• TCA cycle VII (acetate-producers) (8/9 steps found)
• methylaspartate cycle (15/19 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (20/26 steps found)
• reductive TCA cycle I (9/11 steps found)
• ethene biosynthesis V (engineered) (19/25 steps found)
• TCA cycle VI (Helicobacter) (7/9 steps found)
• superpathway of glyoxylate bypass and TCA (9/12 steps found)
• partial TCA cycle (obligate autotrophs) (6/8 steps found)
• mixed acid fermentation (11/16 steps found)
• nitrogen remobilization from senescing leaves (5/8 steps found)
• cytosolic NADPH production (yeast) (2/5 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (3/8 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glutathione metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.42

Sequence Analysis Tools

See Q2RXI4 at UniProt or InterPro

Protein Sequence (405 amino acids)

>Rru_A0356 Isocitrate dehydrogenase (NCBI) (Rhodospirillum rubrum S1H)
MSKITVKNPIVELDGDEMTRIIWQFIKEKLILPYLDVDLLYYDLGVEKRDETEDRITIEA
ANAIKKHHVGVKCATITPDEARVEEFGLKKMWKSPNGTIRNILDGTVFREPIICKNVPRL
VPGWTQPIVIGRHAFGDQYKATDFIVPGAGTLTMSFKPEDGGPAQEYEVFKFPGAGVAMG
MYNLDDSIRGFARACLNYGILRNWPVYLSTKNTILKAYDGRFKDLFQEVFDAEFAERFKA
KGITYEHRLIDDMVACCMKWSGGFVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMTPDGE
TVEAEAAHGTVTRHYRLHQKGKETSTNPIASIFAWTRGLKFRGEFDGTPDVVQFAEALER
VCVETVEAGFMTKDLAILIGPDQPWLTTTQFLDKLDATLKAEMKS