Protein Info for Rru_A0355 in Rhodospirillum rubrum S1H

Annotation: Glutamine amidotransferase class-I (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain
  • amino acids 13 to 203 (191 residues), 231.1 bits, E=6.8e-73
• PF00117: GATase
  • amino acids 14 to 197 (184 residues), 139.3 bits, E=3.1e-44
• PF07722: Peptidase_C26
  • amino acids 81 to 182 (102 residues), 33.6 bits, E=9e-12
• TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain
  • amino acids 212 to 525 (314 residues), 480.1 bits, E=3e-148
• PF02540: NAD_synthase
  • amino acids 222 to 261 (40 residues), 29.1 bits, 1.4e-10
• PF03054: tRNA_Me_trans
  • amino acids 228 to 260 (33 residues), 21.8 bits, see alignment (E = 3.4e-08)
• PF00958: GMP_synt_C
  • amino acids 433 to 524 (92 residues), 143.8 bits, E=3.4e-46

Best Hits

Swiss-Prot: 100% identical to GUAA_RHORT: GMP synthase [glutamine-hydrolyzing] (guaA) from Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 100% identity to rru:Rru_A0355)

MetaCyc: 58% identical to GMP synthetase (Escherichia coli K-12 substr. MG1655)
GMP synthase (glutamine-hydrolyzing). [EC: 6.3.5.2]; 6.3.5.2 [EC: 6.3.5.2]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• L-glutamate and L-glutamine biosynthesis (4/7 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.2

Use Curated BLAST to search for 6.3.5.2

Sequence Analysis Tools

See Q2RXI5 at UniProt or InterPro

Protein Sequence (525 amino acids)

>Rru_A0355 Glutamine amidotransferase class-I (NCBI) (Rhodospirillum rubrum S1H)
MTDRTSVSATDRILIIDFGSQVTQLIARRVRESGVYSEIQPFNTVTAASIAAFAPKGVIL
SGGPASVTAADTPRAPIELFTMGLPVLGICYGQQTMVAQLGGRVEAPDHREFGRAFVEVT
AGCALFDGVWTPGERDQVWMSHGDRVDAIPEGFSVVAVSEGAPYAAIADEARHFYGVQFH
PEVVHTPKGAALLRNFTHGICGCGGDWTMAAFKDQAIARVREQVGSGRVICGLSGGVDSS
VVAALIHEAIGEQLVCVLVDHGMMRQGETEQVVRVFRDRFNITLVHRDASELFLGKLDGV
VDPEAKRKIIGATFIDVFDEEARKVGGADFLAQGTLYPDVIESVSFTGGPSVTIKSHHNV
GGLPERMKMALVEPLRELFKDEVRDLGRELGLPDEMVGRHPFPGPGLAIRIPGQPLTREK
LDILRRADAIYLEEIRNAGLYDVIWQAFAVLLPVRTVGVMGDARSYDFALALRAVTSTDG
MTADYYPFDHTFLGRVANRIINEVKGVNRVVYDITSKPPGTIEWE